TEAD1

TEAD1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TEAD1, AA, NTEF-1, REF1, TCF-13, TCF13, TEAD-1, TEF-1, TEA domain transcription factor 1
Зовнішні ІД OMIM: 189967 MGI: 101876 HomoloGene: 2418 GeneCards: TEAD1
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_021961
NM_001166584
NM_001166585
NM_009346
NM_175559
RefSeq (білок)
NP_068780
NP_001160056
NP_001160057
NP_033372
Локус (UCSC) Хр. 11: 12.67 – 12.94 Mb Хр. 7: 112.28 – 112.51 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TEAD1 (англ. TEA domain transcription factor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 426 амінокислот, а молекулярна маса — 47 946[4].

Послідовність амінокислот
1020304050
MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIY
PPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARR
KSRDFHSKLKDQTAKDKALQHMAAMSSAQIVSATAIHNKLGLPGIPRPTF
PGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPA
PSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGHANHSYS
DPLLESVDIRQIYDKFPEKKGGLKELFGKGPQNAFFLVKFWADLNCNIQD
DAGAFYGVTSQYESSENMTVTCSTKVCSFGKQVVEKVETEYARFENGRFV
YRINRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILLVVTNRDTQETL
LCMACVFEVSNSEHGAQHHIYRLVKD

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література

  • Xiao J.H., Davidson I., Matthes H., Garnier J.-M., Chambon P. (1991). Cloning, expression, and transcriptional properties of the human enhancer factor TEF-1. Cell. 65: 551—568.  PMID 1851669 DOI:10.1016/0092-8674(91)90088-G
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004.  PMID 15489334 DOI:10.1101/gr.2596504
  • Buerglin T.R. (1991). The TEA domain: a novel, highly conserved DNA-binding motif. Cell. 66: 11—12.  PMID 2070413 DOI:10.1016/0092-8674(91)90132-I

Примітки

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11714 (англ.) . Процитовано 8 вересня 2017. {{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, P28347 (англ.) . Архів оригіналу за 8 серпня 2017. Процитовано 8 вересня 2017. 

Див. також

Read other articles:

KaranggondangDesaNegara IndonesiaProvinsiJawa TengahKabupatenJeparaKecamatanMlonggoKode pos59452Kode Kemendagri33.20.07.2014 Luas1.214 HaJumlah penduduk-Kepadatan- Karanggondang adalah desa di kecamatan Mlonggo, Jepara, Jawa Tengah, Indonesia. Desa dengan jumlah penduduk terbanyak dan terluas di wilayah Kecamatan Mlonggo. memiliki tempat wisata pantai yang sangat menarik dan telah banyak dikunjungi oleh wisatawan dosmetik dari luar kota Jepara, keindahan Pantai dua pantai dan kulinernya ...

 

France 3Rhône-AlpesCaractéristiquesCréation 8 novembre 1954Disparition 4 janvier 2016 (disparition informelle)Propriétaire France TélévisionsSlogan « De près, on se comprend mieux. »Format d'image 16/9, 576i (SD), 1080i (HD)Langue FrançaisPays FranceStatut Généraliste publique de proximitéSiège social LyonAncien nom RTF Télé-Lyon (1954-1964)ORTF Télévision Rhône-Alpes (1964-1975)FR3 Rhône-Alpes Auvergne (1975-1992)France 3 Rhône-Alpes Auvergne (1992-2010)Site w...

 

Human emotion This article is about the carnal desire. For other uses, see Lust (disambiguation). Detail: Luxuria (Lust), in The Seven Deadly Sins and the Four Last Things, by Hieronymus Bosch Part of a series onEmotions Affect Classification In animals Emotional intelligence Mood Regulation Interpersonal Dysregulation Valence Emotions Acceptance Admiration Affection Amusement Anger Angst Anguish Annoyance Anticipation Anxiety Apathy Arousal Awe Belongingness Boredom Confidence Confusion Cont...

Totò e le donneIl rifugio in soffittaLingua originaleitaliano Paese di produzioneItalia Anno1952 Durata93 min Dati tecniciB/Nrapporto: 1,37:1 Generecommedia RegiaSteno, Mario Monicelli SoggettoAge & Scarpelli SceneggiaturaAge & Scarpelli, Steno, Mario Monicelli ProduttoreLuigi De Laurentiis, Dino De Laurentiis, Carlo Ponti Casa di produzionePonti-De Laurentis CinematograficaRosa Film Distribuzione in italianoVariety Film FotografiaTonino Delli Colli MontaggioGisa Radicchi Levi Musich...

 

Mythical monster in Chilean mythology This article includes a list of general references, but it lacks sufficient corresponding inline citations. Please help to improve this article by introducing more precise citations. (January 2012) (Learn how and when to remove this template message) Imbunche statue in Plaza de Ancud, Chile. In the Chilote folklore and Chilote mythology of Chiloé Island in southern Chile, the imbunche (Mapudungun: ifünche, lit. short person) is a legendary monster that ...

 

† Человек прямоходящий Научная классификация Домен:ЭукариотыЦарство:ЖивотныеПодцарство:ЭуметазоиБез ранга:Двусторонне-симметричныеБез ранга:ВторичноротыеТип:ХордовыеПодтип:ПозвоночныеИнфратип:ЧелюстноротыеНадкласс:ЧетвероногиеКлада:АмниотыКлада:Синапсиды�...

Perusahaan Umum Percetakan Uang Republik IndonesiaNama dagangPeruriJenisPerusahaan umumIndustriPercetakanPendahuluPN Percetakan KebayoranPN Arta YasaDidirikan15 September 1971; 52 tahun lalu (1971-09-15)KantorpusatJakarta, IndonesiaWilayah operasiIndonesiaTokohkunciDwina Septiani Wijaya[1](Direktur Utama)Rizal Affandi Lukman[2](Ketua Dewan Pengawas)ProdukUangDokumen keamananTinta keamananKertas uangKertas dokumen keamananLogam selain uangMerekPeruri CodePeruri SignPeruri ...

 

1977 collection of science fiction stories by Philip K. Dick The Best of Philip K. Dick Cover of the first edition.AuthorPhilip K. DickCover artistVincent Di FateCountryUnited StatesLanguageEnglishSeriesBallantine's Classic Library of Science FictionGenreScience fictionPublisherDel Rey BooksPublication date1977Media typePrint (paperback)Pagesxiv, 450ISBN0-345-25359-0OCLC2645491Dewey Decimal813/.5/4LC ClassPS3554.I3 B4Preceded byThe Best of C. M. Kornbluth Followed...

 

This article includes a list of general references, but it lacks sufficient corresponding inline citations. Please help to improve this article by introducing more precise citations. (March 2015) (Learn how and when to remove this message) 2011 American filmBorn to Be WildTheatrical release posterDirected byDavid LickleyWritten byDrew FellmanProduced byDrew FellmanStarringBirute GaldikasDaphne SheldrickNarrated byMorgan FreemanCinematographyDavid DouglasEdited byBeth SpiegelMusic byMark Mothe...

Cet article est une ébauche concernant une unité ou formation militaire allemande. Vous pouvez partager vos connaissances en l’améliorant (comment ?) selon les recommandations des projets correspondants. Pour les articles homonymes, voir 36e division. 36e division de grenadiers36. Grenadier-Division Création 3 août 1944 Dissolution 9 octobre 1944 Pays Allemagne Branche Wehrmacht Type Division d'infanterie Rôle Infanterie Guerres Seconde Guerre mondiale modifier  La 36e...

 

Questa voce o sezione sull'argomento filosofi non cita le fonti necessarie o quelle presenti sono insufficienti. Puoi migliorare questa voce aggiungendo citazioni da fonti attendibili secondo le linee guida sull'uso delle fonti. Segui i suggerimenti del progetto di riferimento. David John Chalmers David John Chalmers (Australia, 20 aprile 1966) è un filosofo australiano, appartenente all'area analitica, particolarmente attivo nell'ambito della filosofia della mente. Il suo lavoro è in...

 

Державний комітет телебачення і радіомовлення України (Держкомтелерадіо) Приміщення комітетуЗагальна інформаціяКраїна  УкраїнаДата створення 2003Керівне відомство Кабінет Міністрів УкраїниРічний бюджет 1 964 898 500 ₴[1]Голова Олег НаливайкоПідвідомчі ор...

SMA Negeri 1 TabananInformasiDidirikan5 Agustus 1961JenisNegeriKepala SekolahDr. I Made Jiwa, M.PdJurusan atau peminatanIPA dan IPSRentang kelasX IPA, X IPS, XI IPA, XI IPS, XII IPA, XII IPSKurikulumKurikulum 2013AlamatLokasiJl. Gunung Agung 122, Tabanan, Bali, IndonesiaTel./Faks.(0361) 811164Koordinat8°31′36″S 115°07′50″E / 8.526585°S 115.130488°E / -8.526585; 115.130488Situs websman1tabanan.sch.idMotoMotoTadartham Karma Mukta Sanggah Samacara Be...

 

Mode of human development Sustainable development is an approach to growth and human development that aims to meet the needs of the present without compromising the ability of future generations to meet their own needs.[1][2] The aim is to have a society where living conditions and resources meet human needs without undermining planetary integrity.[3][4] Sustainable development aims to balance the needs of the economy, environment, and social well-being. The Br...

 

Process of population movement to cities Global urbanization map showing the percentage of urbanization and the biggest global population centres per country in 2018, based on UN estimates. Guangzhou, a city of 14.5 million people, is one of the 8 adjacent metropolises located in the largest single agglomeration on Earth, ringing the Pearl River Delta of China.Mumbai is the most populous city in India, and the eighth most populous city in the world, with a total metropolitan area population o...

Siege in China in 1132 Siege of De'anPart of the Jin–Song WarsDate1132LocationDe'an (modern Anlu in eastern Hubei), ChinaResult Song victoryBelligerents Rebels Southern SongCommanders and leaders Li Heng Chen GuiStrength 10,000 ? vteJin–Song Wars Battles: Jingkang Huangtiandang De'an Yancheng Tangdao Caishi Caizhou Treaties: Sea Alliance Treaty of Shaoxing The siege of De'an (德安之戰) was fought as part of the Jin-Song Wars of China in 1132, during the Jin invasion of Hubei and Shaan...

 

العلاقات الألمانية النيوزيلندية ألمانيا نيوزيلندا   ألمانيا   نيوزيلندا تعديل مصدري - تعديل   العلاقات الألمانية النيوزيلندية هي العلاقات الثنائية التي تجمع بين ألمانيا ونيوزيلندا.[1][2][3][4][5] مقارنة بين البلدين هذه مقارنة عامة ومرجعية لل�...

 

Wooden horn of the Samo people The music of Burkina Faso includes the folk music of 60 different ethnic groups. The Mossi people, centrally located around the capital, Ouagadougou, account for 40% of the population while, to the south, Gurunsi, Gurma, Dagaaba and Lobi populations, speaking Gur languages closely related to the Mossi language, extend into the coastal states. In the north and east the Fulani of the Sahel preponderate, while in the south and west the Mande languages are common; ...

У этого термина существуют и другие значения, см. Диана.В Википедии есть статьи о других людях с фамилиями Тюрина, Нельсон и Терёшина. Ирина Нельсон Основная информация Имя при рождении Ирина Анатольевна Терёшина Полное имя Ирина Анатольевна Тюрина[1][2] Дата...

 

1971 filmIn Love, Every Pleasure Has Its PainDirected byGianfranco De BosioWritten byLeo Benvenuti Piero De BernardiGianfranco De Bosio Nino Manfredi Guido StagnaroCinematographyRoberto GerardiMusic byCarlo RustichelliRelease date December 20, 1971 (1971-12-20) LanguageItalian In Love, Every Pleasure Has Its Pain (Italian: La Betìa ovvero in amore, per ogni gaudenza, ci vuole sofferenza) is a 1971 commedia all'italiana film directed by Gianfranco De Bosio. It is based on the c...