FOSL2

FOSL2
Ідентифікатори
Символи FOSL2, Fos-Related Antigen, FRA-2, FRA2, FOS like 2, AP-1 transcription factor subunit
Зовнішні ІД OMIM: 601575 MGI: 102858 HomoloGene: 3845 GeneCards: FOSL2
Шаблон експресії




Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005253
NM_008037
RefSeq (білок)
NP_005244
NP_032063
Локус (UCSC) Хр. 2: 28.39 – 28.42 Mb Хр. 5: 32.29 – 32.32 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

FOSL2 (англ. FOS like 2, AP-1 transcription factor subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 326 амінокислот, а молекулярна маса — 35 193[4].

Послідовність амінокислот
1020304050
MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPT
INAITTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRP
GVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTE
KLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRS
PPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPIS
IAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESC
SKAHRRSSSSGDQSSDSLNSPTLLAL

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, ацетиляція, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Impens F., Radoshevich L., Cossart P., Ribet D. (2014). Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli. Proc. Natl. Acad. Sci. U.S.A. 111: 12432—12437. PMID 25114211 DOI:10.1073/pnas.1413825111
  • Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C. (2015). SUMO-2 orchestrates chromatin modifiers in response to DNA damage. Cell Rep. 10: 1778—1791. PMID 25772364 DOI:10.1016/j.celrep.2015.02.033
  • Matsui M., Tokuhara M., Konuma Y., Nomura N., Ishizaki R. (1990). Isolation of human fos-related genes and their expression during monocyte-macrophage differentiation. Oncogene. 5: 249—255. PMID 2107490

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:3798 (англ.) . Процитовано 28 серпня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, P15408 (англ.) . Архів оригіналу за 18 липня 2017. Процитовано 28 серпня 2017.

Див. також

Read other articles:

EMB-314TipePesawat serang antigerilya, pesawat latihTerbang perdana1996Diperkenalkan2003StatusAktifPengguna utamaBrasilPengguna lainKolombiaChiliRepublik DominikaIndonesiaJumlah produksi650Harga satuanUS$5,46 Juta (Rp84,96 Miliar) EMB-314 (Super Tucano) merupakan sebuah pesawat latih bermesin turboprop sayap rendah (low wing) berkemampuan COIN (Counter Insurgency) atau pesawat serang antigerilya buatan Embraer Defense System, Brasil. EMB-314 Super Tucano merupakan pengembangan dari EMB-312 Tu...

She's a SheikKartu lobiSutradara Clarence Badger Produser Adolph Zukor Jesse Lasky Ditulis olehJohn McDermott (cerita)Lloyd Corrigan (skenario)Grover Jones (skenario)George Marion, Jr. (intertitel)PemeranBebe DanielsSinematograferJ. Roy HuntDistributorParamount PicturesTanggal rilis 12 November 1927 (1927-11-12) Durasi6 rolNegara Amerika Serikat BahasaFilm bisu dengan antar judul Inggris She's a Sheik adalah sebuah film petualangan komedi bisu Amerika Serikat tahun 1927 yang diproduksi d...

Steve Cummings Cummings 2016 Zur Person Vollständiger Name Stephen Phillip Cummings Geburtsdatum 19. März 1981 Nation Vereinigtes Konigreich Vereinigtes Königreich Disziplin Straße / Bahn Fahrertyp Allrounder / Verfolger Körpergröße 189 cm Renngewicht 73 kg Zum Team Aktuelles Team Ineos Grenadiers Funktion Trainer Internationale Team(s) 2005–200620072008–20092010–20112012–20142015–2019 Landbouwkrediet-ColnagoDiscovery ChannelBarloworldSky ProCyclingBMC Racing T...

У Вікіпедії є статті про інших людей із прізвищем Кроулі. Алістер Кровліангл. Aleister Crowley Ім'я при народженні Едуард Александр КровліПрізвисько the Beast 666[1]Псевдо H. D. Carr[2]Народився 12 жовтня 1875(1875-10-12)Лемінґтон,  Велика БританіяПомер 1 грудня 1947(1947-12-01) (72 роки)Гастінґс,...

Кримська Багерове — КримськаКримська — Новоросійськ,Краснодар I — Кримська Північно-Кавказька залізниця станція РозташуванняРозташування  РосіяАдреса Кримськ, Краснодарський крайКоординати 44°54′44″ пн. ш. 38°00′14″ сх. д. / 44.91240000002777322° п...

Bagian dari serial AtatürkMustafa Kemal Atatürk Kehidupan pribadiTanggal lahir · Nama · Kehidupan awal · Keluarga · Kepercayaan agama · Kehendak · Publikasi Karier militerTobruk · Cekungan Anzac · Chunuk Bair · Bukit Scimitar · Sari Bair · Bitlis · Sakarya · Dumlupınar Reformasi AtatürkTujuan · Politik · Sosial · Hu...

Bupati AgamPetahanaAndri Warmansejak 26 Februari 2021KediamanRumah Dinas Bupati AgamDibentuk8 Oktober 1945 (di bawah pemerintahan Indonesia)Pejabat pertamaMuhammad Djosan St. Bidjo RadjoSitus webwww.agamkab.go.id Bupati Agam adalah politisi yang dipilih untuk bertanggung jawab dalam mengatur dan mengelola pemerintahan Kabupaten Agam, sebagai bagian dari sistem penyelenggaraan pemerintahan daerah di Indonesia. Setelah proklamasi kemerdekaan Indonesia, Muhammad Djosan St. Bidjo Radjo diang...

King of the Khmer Empire Harshavarman IKing of the Khmer EmpireReign910 – 923PredecessorYasovarman ISuccessorIshanavarman IIDied923HouseVarman DynastyFatherYasovarman IMotherJayadeviReligionHinduism Baksei Chamkrong, temple of Harshavarman Harshavarman I (Khmer: ហស៌វរ្ម័នទី១; or Rudraloka, died in 923) was an Angkorian king who reigned in 910–923 CE. He is mentioned by David P. Chandler, who is one of the foremost western scholars of Cambodia's modern history.[...

Мировая лига 2001FIVB World League 2001 Время проведения 11 мая — 30 июня 2001 Число участников 16 Стадионы 51 Сайт FIVB.org Призовые места Победитель  Бразилия Второе место  Италия Третье место  Россия Статистика турнира Сыграно матчей 112 Общая посещаемость 693 968 (6196 за игру) 2000...

Scottish factor and illustrator (1789–1856) Drawing of a 'Lettered Serramus' (Serranus scriba) by James Hope Stewart for Sir William Jardine's The Naturalist's Library, 1833–1843. James Hope Stewart of Slodahill (1789–1883) was a Scottish natural history artist, known for his paintings for Sir William Jardine's 40 volume series The Naturalist's Library.[1] Life and work Stewart was born on 2 August 1789 at Hillside, son of William Stewart of Hillhead. About 1816 he married Helen...

Canine native to Ethiopian Highlands Red jackal redirects here. For other uses, see Red Jackal (disambiguation). Ethiopian wolfTemporal range: Late Pleistocene – Recent Ethiopian wolf on the Sanetti Plateau Conservation status Endangered (IUCN 3.1)[1] Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Chordata Class: Mammalia Order: Carnivora Family: Canidae Genus: Canis Species: C. simensis Binomial name Canis simensisRuppell, 1840[2] Ethiopian ...

Piala Liga Inggris 1985–19861985–86 Football League CupNegara Inggris WalesTanggal penyelenggaraan20 Agustus 1985 s.d. 20 April 1986Jumlah peserta92Juara bertahanNorwich CityJuaraOxford United(gelar ke-1)Tempat keduaQueens Park RangersPencetak gol terbanyakJohn Aldridge(5 gol)← 1984–1985 1986–1987 → Piala Liga Inggris 1985–1986 adalah edisi ke-26 penyelenggaraan Piala Liga Inggris, sebuah kompetisi dengan sistem gugur untuk 92 tim terbaik di Inggris. Edisi ini dimenang...

Hotel in Manhattan, New York One Central Park South redirects here. For the skyscraper in Sydney, see One Central Park. For other uses, see Plaza Hotel (disambiguation). Plaza HotelSeen from the corner of 5th Ave. and 58th St.Former namesWestin PlazaAlternative namesThe PlazaEtymologyGrand Army PlazaGeneral informationTypeHotel, apartment hotel, condominiumsArchitectural styleFrench Renaissance-inspired château styleAddress768 Fifth AvenueNew York, New YorkCoordinates40°45′52″N 73°58...

Ruth's mother-in-law in the Book of Ruth Ruth swearing to Naomi by Jan Victors, 1653 Naomi entreating Ruth and Orpah to return to the land of Moab, by William Blake Naomi (Classically /ˈneɪ.oʊmaɪ, neɪˈoʊmaɪ/,[1] colloquially /neɪˈoʊmi, ˈneɪ.oʊmi/;[2] Hebrew: נָעֳמִי‎, Modern: Noʻomī, Tiberian: Nā‘omī) is Ruth's mother-in-law in the Hebrew Bible in the Book of Ruth. The etymology of her name is not certain, but it is possible that it m...

RihannaRihanna with Arabic calligraphy (simple style).Pronunciationri-han-na, rih-a-nnaGenderFemaleOriginWord/namedifferent culture and countriesMeaningFrom the name of the flowerOther namesRelated namesRihanne, Rhian, Rhianna, Rhiannon, Rayhanna, Rayhana, Reyhaneh,Rayhaneh, Rihann Rihanna (Rhianna, Rhiannon; Arabic: ريحـانة, romanized: Rīḥāna, Rayḥāna) is a feminine given name of Welsh and Arabic origin. Arabic name The Arabic form of Rihanna is derived from the name of th...

Air MarshalBalakrishnan SureshPVSM, AVSM, VM, ADCBornThiruvananthapuram, Kerala.[1]Allegiance IndiaService/branch Indian Air ForceYears of service13 December 1980 - 31 July 2020Rank Air MarshalService number16206[2]Commands heldWestern Air CommandSouthern Air CommandAir Officer in Charge of PersonnelAwardsParam Vishisht Seva MedalAti Vishisht Seva MedalVayu Sena Medal Air Marshal Balakrishnan Suresh PVSM, AVSM, VM, ADC is a retired officer of the Indian Air Forc...

Año 1548Años 1545 • 1546 • 1547 ← 1548 → 1549 • 1550 • 1551Decenios Años 1510 • Años 1520 • Años 1530 ← Años 1540 → Años 1550 • Años 1560 • Años 1570Siglos Siglo XV ← Siglo XVI → Siglo XVIITabla anual del siglo XVI Ir al año actualCategorías Categoría principalNacimientos • Fallecimientos 1548 en otros calendariosCalendario gregoriano 1548MDXLVIIIAb Urbe condita 2301Calendario armenio 997Calendario chino 4244-4245Calendario hebreo ...

American actor William WelshWelsh from an ad for The Flirt (1922)Born(1870-02-09)February 9, 1870Philadelphia, PennsylvaniaDiedJuly 16, 1946(1946-07-16) (aged 76)Los Angeles, CaliforniaOccupationActorYears active1912-1936 William Welsh (February 9, 1870 – July 16, 1946) was an American actor of the silent era.[1] He appeared in 153 films between 1912 and 1936. He was born in Philadelphia, Pennsylvania, and died in Los Angeles, California at age 76. Selected filmography...

Pitt Street beralih ke halaman ini. Untuk nama jalan sama di tempat lain, lihat Pitt Street (disambiguasi). Pitt St sekitar tahun 1900 Pitt Street adalah jalan terbesar kedua di Australia yang terletak di distrik bisnis pusat Sydney, New South Wales, Australia. Pitt St terkenal karena mempunyai distrik Pitt St Mall, yang berawal di persimpangan Pitt St dan Market St. Pitt St Mall adalah jalan paling mahal di Australia dan termahal ke-7 di dunia. Riteler terbesar Australia, Westfields akan mem...

This article's lead section may be too short to adequately summarize the key points. Please consider expanding the lead to provide an accessible overview of all important aspects of the article. (September 2012) Basketball team season2012–13 Barangay Ginebra San Miguel seasonHead coachSiot Tanquincen (September–December 2012)Alfrancis Chua (January–July 2013)Ato Agustin (July 2013–present)Owner(s)Ginebra San Miguel, Inc. (a San Miguel Corporation subsidiary)Philippine Cup re...