RORB

RORB
Ідентифікатори
Символи RORB, NR1F2, ROR-BETA, RZR-BETA, RZRB, bA133M9.1, RAR-related orphan receptor beta, RAR related orphan receptor B, EIG15
Зовнішні ІД OMIM: 601972 MGI: 1343464 HomoloGene: 38250 GeneCards: RORB
Пов'язані генетичні захворювання
аметропія, generalized epilepsy[1]
Реагує на сполуку
третиноїн[2]
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006914
NM_001365023
NM_001043354
NM_001289921
NM_146095
RefSeq (білок)
NP_008845
NP_001351952
NP_001036819
NP_001276850
NP_666207
Локус (UCSC) Хр. 9: 74.5 – 74.69 Mb Хр. 19: 18.91 – 19.09 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

RORB (англ. Nuclear receptor ROR-beta) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[5] Довжина поліпептидного ланцюга білка становить 470 амінокислот, а молекулярна маса — 53 220[6].

Послідовність амінокислот
1020304050
MCENQLKTKADATAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQ
NNASYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQ
RDSLYAEVQKHQQRLQEQRQQQSGEAEALARVYSSSISNGLSNLNNETSG
TYANGHVIDLPKSEGYYNVDSGQPSPDQSGLDMTGIKQIKQEPIYDLTSV
PNLFTYSSFNNGQLAPGITMTEIDRIAQNIIKSHLETCQYTMEELHQLAW
QTHTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRITGFMELCQN
DQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLV
NEAFDFAKNLCSLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIY
FALQHVIQKNHLDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPEIVN
TLFPPLYKELFNPDCATGCK

Кодований геном білок за функціями належить до рецепторів, активаторів, білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біологічні ритми. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література

Примітки

  1. Захворювання, генетично пов'язані з RORB переглянути/редагувати посилання на ВікіДаних.
  2. Сполуки, які фізично взаємодіють з Nuclear receptor ROR-beta переглянути/редагувати посилання на ВікіДаних.
  3. Human PubMed Reference:.
  4. Mouse PubMed Reference:.
  5. HUGO Gene Nomenclature Commitee, HGNC:10259 (англ.) . Архів оригіналу за 4 квітня 2016. Процитовано 7 вересня 2017. [Архівовано 2016-04-04 у Wayback Machine.]
  6. UniProt, Q92753 (англ.) . Архів оригіналу за 7 серпня 2017. Процитовано 7 вересня 2017.

Див. також

Read other articles:

5th-century Greek Neoplatonist philosopher Not to be confused with Procles. This article is about Proclus Diadochus, the Neoplatonist philosopher. For other people named Proclus, see Proclus (disambiguation). Proclus LyciusThe beginning of the first Latin edition of Proclus' Commentary on Euclid's ElementsBorn412Constantinople, Thracia, Eastern Roman EmpireDied485 (aged 72–73)Athens, Achaea, Eastern Roman EmpireOther namesThe SuccessorEraAncient philosophyRegionWestern philosophySchool...

 

 

This user may have left Wikipedia. Penbat has not edited Wikipedia since September 2019. As a result, any requests made here may not receive a response. If you are seeking assistance, you may need to approach someone else. Archives Archive 1 Archive 2 Archive 3 Archive 4 Archive 5 Welcome to Wikipedia!!! Hello Penbat! Welcome to Wikipedia! Thank you for your contributions. If you decide that you need help, check out Wikipedia:Where to ask a question, ask me on my talk page, or place {{helpme}...

 

 

2015 International Court of Justice decision Not to be confused with Genocide of Serbs in the Independent State of Croatia. Application of the Convention on the Prevention and Punishment of the Crime of Genocide (Croatia v. Serbia)The Peace Palace in The Hague, the seat of the ICJ.CourtInternational Court of JusticeCitation(s)Application of the Convention on the Prevention and Punishment of the Crime of Genocide (Croatia v. Serbia) The Application of the Convention on the Prevention and Punis...

Ribera, Agrigento commune di Italia Ribera (it) Tempat Negara berdaulatItaliaRegion otonom dengan status khususSiciliaProvinsi di ItaliaProvinsi Agrigento NegaraItalia Ibu kotaRibera PendudukTotal17.836  (2023 )GeografiLuas wilayah118,52 km² [convert: unit tak dikenal]Ketinggian223 m Berbatasan denganBivona Calamonaci Caltabellotta Cattolica Eraclea Cianciana Sciacca SejarahSanto pelindungNikolas dari Myra Informasi tambahanKode pos92016 Zona waktuUTC+1 UTC+2 Kode telepon0925 ID IS...

 

 

Tara AirBerkas:Tara Air logo.jpg IATA ICAO Kode panggil – – TARA AIR Didirikan2009PenghubungKathmanduPenghubung sekunderSurkhet, NepalgunjArmada7Tujuan18SloganHelping Build the Rural NepalProviding Access Everywhere in Nepal, to all...Perusahaan indukYeti AirlinesKantor pusatKathmandu, NepalTokoh utamaLhakpa Sonam SherpaSitus webhttp://www.taraair.com/ DHC-6 Twin Otter Tara Air di Simara (menunjukkan bekas logo Yeti Airlines). Tara Air Pvt.Ltd adalah maskapai penerbangan yang berkantor pu...

 

 

United States historic placePike's StockadeU.S. National Register of Historic PlacesU.S. National Historic LandmarkColorado State Register of Historic Properties Reproduction of the fort, 2009Show map of ColoradoShow map of the United StatesNearest citySanford, ColoradoCoordinates37°17′37.07″N 105°48′35.8″W / 37.2936306°N 105.809944°W / 37.2936306; -105.809944Area4 acres (1.6 ha)Built1807ArchitectZebulon PikeNRHP reference No.66000244CSRHP&#...

For other units with the same regimental number, see 92nd Regiment of Foot (disambiguation). 92nd (Gordon Highlanders) Regiment of FootColours of the 92nd (Gordon Highlanders) Regiment of FootActive1794–1881Country Kingdom of Great Britain (1794–1800) United Kingdom (1801–1881)Branch British ArmyTypeHighland Infantry RegimentSizeOne battalion (two battalions 1803–1814)Garrison/HQCastlehill Barracks, AberdeenNickname(s)The Gay Gordons[1]EngagementsNapoleonic WarsCrime...

 

 

Radio station in Waycross, GeorgiaWYNRWaycross, GeorgiaBroadcast areaSouth East Georgia & North East FloridaFrequency102.5 MHzBrandingWYNR 102.5ProgrammingFormatCountryAffiliationsPremiere NetworksOwnershipOwneriHeartMedia, Inc.(iHM Licenses, LLC)Sister stationsWBGA, WGIG, WHFX, WQGAHistoryFormer call signsWQCW (1983–1986)WAYX-FM (1986–1987)WBGA (1987–2002)Technical informationFacility ID57785ClassC1ERP97,000 wattsHAAT303 meters (994 ft)Transmitter coordinates31°9′22.00″N ...

 

 

GrimaldiGrimaldi-Goyon-Chalencon-PolignacDeo Juvante[N 1]Fusato d'argento e di rossoStato Repubblica di Genova Monaco Titoli Principe di Monaco(1612–1793)(1814–presente) Doge della Repubblica di Genova(1671–1673)(1703–1705)(1728–1730)(1752–1754)(1756–1758)(1773–1775) Duca di Valentinois(1642–1715)(1716–1793)(1814–presente) Marchese di Baux(1642–1793)(1814–presente) Signore di Monaco(1297–1301)(1331–1357)(1395–1395)(1397–1402)(1419–1436)(1436–...

Trigonometric functions introduced by Indian mathematicians and astronomers Jyā, koṭi-jyā and utkrama-jyā are three trigonometric functions introduced by Indian mathematicians and astronomers. The earliest known Indian treatise containing references to these functions is Surya Siddhanta.[1] These are functions of arcs of circles and not functions of angles. Jyā and koti-jyā are closely related to the modern trigonometric functions of sine and cosine. In fact, the origins of the...

 

 

Voce principale: Polystachya. Elenco delle specie di Polystachya.[1] A Indice A B C D E F G H I J K L M N O P Q R S T U V W X Y Z ? Polystachya adansoniae Polystachya aconitiflora Summerh., 1942 Polystachya acridolens Summerh., 1947 Polystachya acuminata Summerh., 1947 Polystachya adansoniae Rchb.f., 1865 Polystachya aethiopica P.J.Cribb, 1978 Polystachya affinis Lindl., 1830 Polystachya albescens Ridl., 1887 Polystachya alicjae Mytnik Polystachya alpina Lindl., 1862 Polystachya anas...

 

 

Para otros usos de este término, véase Roberto Álvarez (desambiguación). Roberto Álvarez Roberto Álvarez en 2015Información personalNombre de nacimiento Roberto Álvarez RuizNacimiento 13 de mayo de 1956 (68 años)Gijón, Asturias, España EspañaNacionalidad EspañolaFamiliaCónyuge Marta MolinaHijos Samuel Álvarez Molina y Olivia Álvarez MolinaInformación profesionalOcupación ActorSitio web www.robertoalvarez.com[editar datos en Wikidata] Roberto Álvarez Rui...

L'exemplum (plurale: exempla) è un genere letterario diffuso nel Medioevo. Si tratta tipicamente di un racconto (dichiarato come veridico) in cui il protagonista, grazie ad un determinato comportamento, ha raggiunto un certo risultato, corrispondente di solito alla salvezza dell'anima. Spesso il racconto del fatto scaturisce da una sentenza o da un momento della vita di un santo. Tali exempla venivano usati dai predicatori per dimostrare attraverso l'esempio il loro messaggio; la ragione...

 

 

يفتقر محتوى هذه المقالة إلى الاستشهاد بمصادر. فضلاً، ساهم في تطوير هذه المقالة من خلال إضافة مصادر موثوق بها. أي معلومات غير موثقة يمكن التشكيك بها وإزالتها. (ديسمبر 2018) سلوفاكيا كأس العالم 2010 الاتحاد المشرف اتحاد سلوفاكيا لكرة القدم البلد المضيف  جنوب إفريقيا المشاركة ر...

 

 

دوري الدرجة الثانية السعودي الموسم 2007–08 البلد السعودية  الفائز نادي العروبة صاعدون نادي العروبةنادي حطين هابطون نادي التهامينادي الغوطة المباريات الملعوبة 264 تعديل مصدري - تعديل   دوري الدرجة الثانية السعودي 2007–08 كان موسم من دوري الدرجة الثانية السعودي، وقد شارك ف�...

Tyrannosaurid dinosaur genus from Late Cretaceous of Mongolia TarbosaurusTemporal range: Late Cretaceous (Maastrichtian), 72–66 Ma PreꞒ Ꞓ O S D C P T J K Pg N Possible Campanian record[1][2] Skeleton on exhibit in Maryland Science Center Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Chordata Clade: Dinosauria Clade: Saurischia Clade: Theropoda Family: †Tyrannosauridae Subfamily: †Tyrannosaurinae Clade: †Tyrannosaurini Genus: †Tarbosau...

 

 

This article may need to be rewritten to comply with Wikipedia's quality standards. You can help. The talk page may contain suggestions. (October 2016) County-level & Sub-prefectural city in Guangdong, People's Republic of ChinaGaozhou 高州市KochowCounty-level & Sub-prefectural cityGaozhouLocation in GuangdongCoordinates: 21°55′28″N 110°50′32″E / 21.92444°N 110.84222°E / 21.92444; 110.84222CountryPeople's Republic of ChinaProvinceGuangdongPrefect...

 

 

Pour l’article homonyme, voir Constantinople (ensemble musical). Carte montrant le relief de Constantinople et ses murs pendant la période byzantine. La numérotation des collines et des régions administratives est en brun. Constantinople (en latin Constantinopolis, en grec ancien Κωνσταντινούπολις / Kônstantinoúpolis, en turc ottoman قسطنطينية (Kostantiniyye)) est, de sa fondation en 330 par Constantin Ier (empereur de 306 à 337), sur le site de l’anc...

This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Blossom Park – news · newspapers · books · scholar · JSTOR (September 2014) (Learn how and when to remove this message) Neighbourhood in Ottawa, Ontario, CanadaBlossom ParkNeighbourhoodBlossom ParkCoordinates: 45°20′39″N 75°38′15″W / ...

 

 

Third of a historic county in England This article is about the historic riding and former county subdivision. For the modern county, see North Yorkshire. For the district in that county of the same name, see North Yorkshire (district). North Riding redirects here. For other uses, see North Riding (disambiguation). County of York, North Riding Flag of North Riding (2013)North Riding shown within EnglandArea • 19111,359,600 acres (5,502 km2) • 19611,376,607 acres (...