TAF9B

TAF9B
Ідентифікатори
Символи TAF9B, DN-7, DN7, TAF9L, TAFII31L, TFIID-31, TATA-box binding protein associated factor 9b
Зовнішні ІД OMIM: 300754 MGI: 3039562 HomoloGene: 47969 GeneCards: TAF9B
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_015975
NM_001001176
NM_001167988
RefSeq (білок)
NP_057059
NP_001001176
NP_001161460
Локус (UCSC) Хр. X: 78.13 – 78.14 Mb Хр. X: 105.25 – 105.26 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TAF9B (англ. TATA-box binding protein associated factor 9b) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі.[3] Довжина поліпептидного ланцюга білка становить 251 амінокислот, а молекулярна маса — 27 622[4].

Послідовність амінокислот
1020304050
MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTI
LDDAKIYSSHAKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKN
QTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQGRLVPRLSVGA
VSSKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPA
TTAVQNVLINPSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDI
M

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання. Локалізований у ядрі.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:17306 (англ.) . Процитовано 13 вересня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, Q9HBM6 (англ.) . Архів оригіналу за 31 серпня 2017. Процитовано 13 вересня 2017.

Див. також

Read other articles:

Amano Megumi wa Sukidarake!Gambar sampul manga volume pertama天野めぐみはスキだらけ!GenreKomedi, penggalan kehidupan[1] MangaPengarangNekoguchiPenerbitShogakukanMajalahShōnen Sunday Super (25 Agustus – 25 November 2015)Weekly Shōnen Sunday (16 Desember 2015 – sekarang)DemografiShōnenTerbit25 Agustus 2015 – sekarangVolume15 (Daftar volume)  Portal anime dan manga Amano Megumi wa Sukidarake! (Jepang: 天野めぐみはスキだらけ!code: ja is deprecated ,...

Centratherum Centratherum punctatum Klasifikasi ilmiah Domain: Eukaryota Kerajaan: Plantae Upakerajaan: Trachaeophyta Divisi: Magnoliophyta Kelas: Magnoliopsida Subkelas: Asteridae Ordo: Asterales Famili: Asteraceae Tribus: Vernonieae Genus: CentratherumCassini Spesies tipe Centratherum punctatumCassini Spesies[1] Centratherum australianum (K.Kirkman) A.R.Bean Centratherum cardenasii H.Rob. Centratherum confertum K.Kirkman Centratherum phyllolaenum (DC.) Benth. ex Hook.f Centratherum ...

Para el campeonato que perteneció a la extinta promoción GFW, véase GFW Global Championship (2015-2017). Impact World Championship El campeón Alex Shelley con el diseño actual del campeonato.Nombre Impact World ChampionshipPromoción Impact WrestlingReinados oficiales 58Campeón actual Alex ShelleyFecha de obtención 9 de junio de 2023Fecha de creación 13 de mayo de 2007Primer campeón Kurt AngleOtros nombres Véase sección           &#...

Сари-Баш Джамісі Мечеть Сари-Баш, 2020 рік Координати: 45°34′11″ пн. ш. 33°46′53″ сх. д. / 45.56969° пн. ш. 33.78146° сх. д. / 45.56969; 33.78146Тип споруди мечетьРозташування  Україна, Сари-БашНалежність ісламАдреса вулиця Нова, 28 Сари-Баш Джамісі (Автономна Ре

Star Wars: Episode IX - The Rise of Skywalker Logotipo de la película.Título Star Wars: El ascenso de SkywalkerFicha técnicaDirección J.J. Abrams[1]​Producción Kathleen KennedyJ. J. AbramsMichelle RejwanGuion J. J. AbramsChris TerrioHistoria Derek ConnollyColin TrevorrowJ. J. AbramsChris TerrioBasada en Star Wars, de George LucasMúsica John WilliamsSonido John H. WilliamsMaquillaje Zoe Clare BrownFotografía Dan MindelMontaje Maryann BrandonStefan GrubeVestuario Michael KaplanProt...

2016 American horror film The WatcherDirected byRyan RothmaierWritten byRyan RothmaierProduced byDave FrauncesJason RyanStarringErin CahillEdi GathegiMusic byCarson AuneRelease date October 1, 2016 (2016-10-01) Running time89 minutesCountryUnited StatesLanguageEnglish The Watcher is a 2016 American horror film[1] directed by Ryan Rothmaier[2] and starring Erin Cahill and Edi Gathegi. The film follows a young couple who after moving into a new home find themselve...

بلاي ستيشن 5PlayStation 5الشعارجهاز بلاي ستيشن 5 الأساسي (مع محرك أقراص ضوئي) ووحدة تحكم دول سينسمعلومات عامةالنوع منصة ألعاب فيديو منزليةالصانع سوني، فوكسكونالشعار Play Has No Limits (بالإنجليزية)[3] المطور سوني إنتراكتيف إنترتينمنتعائلة المنتج بلاي ستيشنالجيل التاسعالسعر المبدئي

Colinas del desierto de Judea. El desierto de Judea (en hebreo: מִדְבַּר יְהוּדָה, Midbar Yehuda; en árabe: صحراء يهودا Sahraa' Yahuda;) es un desierto en Israel y Cisjordania, que se extiende desde el este de Jerusalén hasta el mar Muerto. También es conocido como el desierto de Yeshimon.[1]​ Bajo el nombre de El-Bariyah, ha sido nominado tentativamente para convertirse en Patrimonio Mundial de la Humanidad, por las ruinas de monasterios en su territorio. E...

Dieser Artikel beschreibt den Maler und Arzt, für den Autor und Kabarettisten siehe unter Bänz Friedli. Bendicht Friedli (2014) Bendicht Friedli (* 20. Mai 1930 in Bern; † 17. Oktober 2014 in Unterseen) war ein Schweizer Maler und Arzt. Inhaltsverzeichnis 1 Leben 2 Werk 3 Ausstellungen (Auswahl) 3.1 Einzelausstellungen 3.2 Gruppenausstellungen 4 Werke in Sammlungen (Auswahl) 5 Weblinks 6 Literatur 7 Einzelnachweise Leben Bendicht Friedli, auch genannt „Bänz“, wuchs in Bern auf. Er be...

Moravia MoravaHistorical landThe town of Mikulov BenderaLambang kebesaranHimne daerah: VariousPredominantly Jsem Moravan or Moravo, Moravo[1]Moravia (green) in relation to the current regions of the Czech RepublicLocation of Moravia in the European UnionKoordinat: 49°30′N 17°00′E / 49.5°N 17°E / 49.5; 17Koordinat: 49°30′N 17°00′E / 49.5°N 17°E / 49.5; 17Country Czech RepublicRegionsMoravian-Silesian Region, Olomouc R...

Moneybagg Yo discographyMoneybagg Yo in 2020Studio albums4Compilation albums1EPs1Singles44Mixtapes15Collaborative mixtapes1 The discography of Moneybagg Yo, an American rapper, consists of four studio albums, one compilation album, 16 mixtapes (including one collaborative mixtape), and 44 singles (including 18 as a featured artist). His debut studio album, Reset, was released on November 2, 2018. His second studio album, 43va Heartless, was released on May 24, 2019. Moneybagg Yo's third studi...

This article uses bare URLs, which are uninformative and vulnerable to link rot. Please consider converting them to full citations to ensure the article remains verifiable and maintains a consistent citation style. Several templates and tools are available to assist in formatting, such as reFill (documentation) and Citation bot (documentation). (August 2022) (Learn how and when to remove this template message) Vinnie Paz discographyPaz in 2012Studio albums7Compilation albums4EPs2Mixtapes7Coll...

American comic book artist and illustrator Steve EllisEllis at the 2011 New York Comic ConNationalityAmericanArea(s)Artist, InkerNotable worksHigh MoonThe SilencersCrimson DynamoAwardsHarvey Award, 2009Paper Screen Gem AwardGalerie d'art Yves Laroche: Street Camp Juried Show 2006Best in Show: Gen Con Art Show 2005http://www.hypersteve.com Steve Ellis is an American comic book artist and illustrator who has worked for Wizards of the Coast, DC Comics, Wildstorm, White Wolf, Moonstone Books and ...

Jardim do Castelo de São Jorge Jardim do Castelo de São Jorge Localização Castelo de São Jorge, Lisboa País  Portugal Tipo Público Administração Câmara Municipal de Lisboa O Jardim do Castelo de São Jorge é um jardim em Lisboa.[1] Situa-se dentro das muralhas do castelo e é bastante agradável, tranquilo e muito frequentado por turistas. Possui zonas relvadas e 21 espécies de árvores, das quais se destacam sobreiros, alfarrobeiras, pinheiros-mansos, figueiras e oliveiras, ...

Car model Motor vehicle Tofaş ŞahinTofaş Şahin in EgyptOverviewManufacturerTofaşAlso calledTofaş DoğanTofaş Kartal (station wagon)Nasr SahinHolland DOCCProduction1981–2010AssemblyBursa, TurkeyCairo, Egypt (Nasr, until 2010)Addis Ababa, Ethiopia (Holland Car, until 2010)Body and chassisClassFamily carBody style4-door sedan 5-door station wagon (Kartal)LayoutFR layoutRelatedFiat 131SEAT 131PowertrainEngineGasoline: 1,297 cc (79.1 cu in) 131 A0.000 OHV I4 1,585...

Polish-American engineer and army officer Włodzimierz KrzyżanowskiWłodzimierz KrzyżanowskiBirth nameWłodzimierz Bonawentura KrzyżanowskiNickname(s)KrizBorn(1824-07-08)July 8, 1824Rożnowo, Poznań, PrussiaDiedJanuary 31, 1887(1887-01-31) (aged 62)New York City, United StatesPlace of burialArlington National CemeteryAllegiance United States (Union)Service/branchUnited States ArmyUnion ArmyYears of service1861–1865Rank Colonel Brevet Brigadier General Brigadier Genera...

OlympiacosBerkas:Olympiacos FC logo.svgNama lengkapΟλυμπιακός Σύνδεσμος Φιλάθλων ΠειραιώςOlympiakós Sýndesmos Filáthlo̱n Peiraió̱s(Klub Olympiacos Piraeus)JulukanThrylos (Legenda)Erythrolefki (Merah-Putih)Berdiri10 Maret 1925; 98 tahun lalu (1925-03-10)StadionStadion Karaiskaki, Piraeus, Yunani(Kapasitas: 33.500)PemilikEvangelos MarinakisPresidenEvangelos MarinakisManajer MíchelLigaSuper League Greece2020-21Super League Greece, 1stSitus webS...

Ini adalah nama Maluku (Ambon), marganya adalah Mohede Mike MohedeMike MohedeLahirMichael Prabawa Mohede(1983-11-07)7 November 1983Jakarta, IndonesiaMeninggal31 Juli 2016(2016-07-31) (umur 32)Tangerang, IndonesiaNama lainMikePekerjaanPenyanyiOrang tua(Alm) Arthur Mohede Amin YudhayaniKarier musikGenrePopR&BSoulgospelTahun aktif2005–2016LabelSony Music Entertainment IndonesiaPro-MImpact Michael Prabawa Mohede atau Mike Mohede (7 November 1983 – 31 Juli 2016) ada...

2018 Indian filmRosogollaTheatrical release posterDirected byPavelWritten bySmaranjit Chakraborty and PavelScreenplay bySmaranjit Chakraborty and PavelStory bySmaranjit Chakraborty and PavelProduced byNandita Roy and Shiboprosad MukherjeeStarring Ujaan Ganguly Abantika Biswas Rajatava Dutta Kharaj Mukherjee Kaushik Sen Subhashree Ganguly Aparajita Auddy [2]CinematographySupriyo DuttaMusic byArnab DuttProductioncompanyWindows ProductionDistributed byWindows ProductionRelease date 21...

2010 Philippine television series IluminaTitle cardGenreFantasy dramaCreated byDode CruzDirected by Mark A. Reyes Topel Lee Creative directorJun LanaStarring Rhian Ramos Aljur Abrenica Jackie Rice Theme music composerArmi MillareCountry of originPhilippinesOriginal languageTagalogNo. of episodes80ProductionExecutive producerWinnie Hollis-ReyesEditors Ver Custodio Robert Ryan Reyes Benedict Lavastida Camera setupMultiple-camera setupRunning time30-45 minutesProduction companyGMA Entertainment ...