ESR2

ESR2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ESR2, ER-BETA, ESR-BETA, ESRB, ESTRB, Erb, NR3A2, estrogen receptor 2, ODG8
Зовнішні ІД OMIM: 601663 MGI: 109392 HomoloGene: 1100 GeneCards: ESR2
Реагує на сполуку
Естрадіол, діетилстільбестрол, estriol, estrone, ethinylestradiol, Геністейн, тамоксифен, Бісфенол А, lasofoxifene, bazedoxifene, raloxifene, fosfestrol, acolbifene, erteberel, estramustine phosphate sodium, droloxifene[1]
Шаблон експресії




Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_010157
NM_207707
RefSeq (білок)
NP_034287
NP_997590
Локус (UCSC) Хр. 14: 64.08 – 64.34 Mb Хр. 12: 76.17 – 76.22 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ESR2 (англ. Estrogen receptor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 530 амінокислот, а молекулярна маса — 59 216[5].

Послідовність амінокислот
1020304050
MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYS
PAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYA
EPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCA
VCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKS
CQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGG
HAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTK
LADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDH
PGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCV
KAMILLNSSMYPLVTATQDADSSRKLAHLLNAVTDALVWVIAKSGISSQQ
QSMRLANLLMLLSHVRHASNKGMEHLLNMKCKNVVPVYDLLLEMLNAHVL
RGCKSSITGSECSPAEDSKSKEGSQNPQSQ

Кодований геном білок за функціями належить до рецепторів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ліпідами, іонами металів, іоном цинку, ДНК, стероїдами. Локалізований у ядрі.

Література

  • Lee, E.B.; Chakravarthi, V.P.; Wolfe, M.W.; Rumi, M.A.K. ERβ Regulation of Gonadotropin Responses during Folliculogenesis. Int. J. Mol. Sci. 2021, 22, 10348. https://doi.org/10.3390/ijms221910348 (англ.)
  • Leung Y.K., Mak P., Hassan S., Ho S.M. (2006). Estrogen receptor (ER)-beta isoforms: a key to understanding ER-beta signaling. Proc. Natl. Acad. Sci. U.S.A. 103: 13162—13167. PMID 16938840 DOI:10.1073/pnas.0605676103
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Li L.C., Yeh C.C., Nojima D., Dahiya R. (2000). Cloning and characterization of human estrogen receptor beta promoter. Biochem. Biophys. Res. Commun. 275: 682—689. PMID 10964723 DOI:10.1006/bbrc.2000.3363
  • Mosselman S., Polman J., Dijkema R. (1996). ER beta: identification and characterization of a novel human estrogen receptor. FEBS Lett. 392: 49—53. PMID 8769313 DOI:10.1016/0014-5793(96)00782-X
  • Pace P., Taylor J., Suntharalingam S., Coombes R.C., Ali S. (1997). Human estrogen receptor beta binds DNA in a manner similar to and dimerizes with estrogen receptor alpha. J. Biol. Chem. 272: 25832—25838. PMID 9325313 DOI:10.1074/jbc.272.41.25832
  • Caira F., Antonson P., Pelto-Huikko M., Treuter E., Gustafsson J.-A. (2000). Cloning and characterization of RAP250, a nuclear receptor coactivator. J. Biol. Chem. 275: 5308—5317. PMID 10681503 DOI:10.1074/jbc.275.8.5308

Примітки

  1. Сполуки, які фізично взаємодіють з estrogen receptor 2 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:3468 (англ.) . Архів оригіналу за 22 березня 2016. Процитовано 11 вересня 2017.
  5. UniProt, Q92731 (англ.) . Архів оригіналу за 23 серпня 2017. Процитовано 11 вересня 2017.

Див. також


Read other articles:

يفتقر محتوى هذه المقالة إلى الاستشهاد بمصادر. فضلاً، ساهم في تطوير هذه المقالة من خلال إضافة مصادر موثوق بها. أي معلومات غير موثقة يمكن التشكيك بها وإزالتها. (ديسمبر 2018)   لمعانٍ أخرى، طالع كسر الخواطر (توضيح). كسر الخواطر مسلسل كسر الخواطر النوع دراما تأليف وداد الكواري

Cemitério Monumental de MilãoPaís  ItáliaLocalização Milão ItáliaEstatuto patrimonial Herança nacional italiana (d)Find a Grave 639300Coordenadas 45° 29′ 09″ N, 9° 10′ 45″ Leditar - editar código-fonte - editar Wikidata Vista do Cemitério Monumental de Milão. O Cemitério Monumental de Milão é um dos dois grandes cemitérios da cidade italiana de Milão, tendo sido projetado pelo arquiteto Carlo Maciachini (1818-1899). Inaugurado em 1866, é conhecido lo...

Para otros usos de este término, véase Araucana (desambiguación). La Araucana de Alonso de Ercilla Segunda edición de la Primera Parte del Poema de 1574, Biblioteca Nacional de ChileGénero Poema épicoTema(s) Primera etapa de la Guerra de Arauco entre españoles y mapuchesIdioma Español Ciudad MadridPaís EspañaFecha de publicación 1569, Vol. 11578, Vol. 21589, Vol. 3Formato PapelTexto en español La araucana en WikisourceContenido La araucana primera parteLa araucana segunda par...

Senen beralih ke halaman ini. Untuk nama hari, lihat Senin. Untuk kegunaan lain, lihat Senen (disambiguasi). SenenKecamatanPasar Senen tahun 1970-anLetak kecamatan Senen di Jakarta PusatPeta lokasi Kecamatan SenenSenenPeta lokasi Kecamatan SenenTampilkan peta JakartaSenenSenen (Jawa)Tampilkan peta JawaSenenSenen (Indonesia)Tampilkan peta IndonesiaKoordinat: 6°11′S 106°51′E / 6.18°S 106.85°E / -6.18; 106.85Negara IndonesiaProvinsiDKI JakartaKota Administras...

Artikel ini sebatang kara, artinya tidak ada artikel lain yang memiliki pranala balik ke halaman ini.Bantulah menambah pranala ke artikel ini dari artikel yang berhubungan atau coba peralatan pencari pranala.Tag ini diberikan pada Januari 2023. Artikel ini tidak memiliki referensi atau sumber tepercaya sehingga isinya tidak bisa dipastikan. Tolong bantu perbaiki artikel ini dengan menambahkan referensi yang layak. Tulisan tanpa sumber dapat dipertanyakan dan dihapus sewaktu-waktu.Cari sumber:...

  ميّز عن أم الدم الأبهرية البطنية. Aortic aneurysm أم الدم الأبهرية معلومات عامة الاختصاص جراحة أوعية دموية  من أنواع مرض الأبهر  [لغات أخرى]‏،  وأم الدم،  وعلامة سريرية،  ومرض  تعديل مصدري - تعديل   أم الدم الأبهرية[1] هو مصطلح عام يعني (تمدد أو توسع ا...

Term with multiple meanings in Christian theology Part of a series on theEastern Orthodox ChurchMosaic of Christ Pantocrator, Hagia Sophia Overview Structure Theology (History of theology) Liturgy Church history Holy Mysteries View of salvation View of Mary View of icons Background Crucifixion / Resurrection / Ascensionof Jesus Christianity Christian Church Apostolic succession Four Marks of the Church Orthodoxy Organization Autonomy Autocephaly Patriarchate Ecumenical ...

Liga Nasional Wanita FANegaraInggrisKonfederasiUEFA (Eropa)Dibentuk1991Musim perdana1991–1992Divisi6 Divisi Utama Utara Divisi Utama Selatan Divisi Primer Utara Divisi Primer Midlands Divisi Primer Tenggara Divisi Primer Barat Daya Liga Primer Nasional (1991–2013)Tingkat pada piramida3–4 (sejak 2014)Promosi keKejuaraan Wanita (sejak 2014–15)Degradasi keLiga RegionalPiala domestikPiala Wanita FAPiala ligaPiala Liga Nasional Wanita FA, Plakat Liga Nasional FAKlub tersuksesArsenal (12 ge...

Gertrude Käsebier: Stieglitz in 1902 Alfred Stieglitz (Hoboken (New Jersey), 1 januari 1864 – New York, 13 juli 1946) was een Amerikaans fotograaf en promotor van de moderne kunst. Naast het fotograferen is Stieglitz ook bekend door de kunstgalerieën die hij in het begin van de 20e eeuw in New York dreef. In deze galerieën introduceerde hij veel Europese avant-garde kunstenaars in Amerika. Hij gaf een tijdschrift uit, Camera Work, waarin hij foto's van vooraanstaande fotografen publiceer...

Jim Nabors performed Back Home Again in Indiana before the start of the race nearly every year from 1972 to 2014. 2011 Indianapolis 500 winner Dan Wheldon celebrating with a bottle of milk in victory lane. Due to the longevity of the Indianapolis 500, numerous traditions surrounding the race have developed over the years. Traditions include procedures for the running of the race, scheduling, and pre-race and post-race festivities. For many fans, these traditions are an important aspect of the...

1935 film by P. K. Raja Sandow MenakaPosterDirected byP. K. RajasandowScreenplay byKandhasamy MudaliarBased onMenakaby Vaduvoor K. Duraiswamy IyengarStarringT. K. ShanmugamT. K. BhagavathiCinematographyNemai GhoshMusic byT. K. MuthusamyProductioncompanySri Shanmuganandha Talkie CompanyRelease date 6 April 1935 (1935-04-06) [1]CountryIndiaLanguageTamil Menaka is a 1935 Indian Tamil-language drama film directed by P. K. Rajasandow and produced by Sri Shanmuganandha Talkie...

Finnish rifle Tikka M65 Tikka M65 Super Sporter.TypeRifleSniper riflePlace of originFinlandProduction historyDesignerTikkakoskiDesigned1969[1]ManufacturerTikkakoskiProduced1969–1989[2]VariantsTikka LSA65 StandardTikka LSA65 DeluxeTikka LSA65 SporterTikka M65 StandardTikka M65 DeluxeTikka M65 TrapperTikka M65 FullstockTikka M65 HirvesterTikka M65 BattueTikka M65 ContinentalTikka M65 SporterTikka M65 Super SporterTikka M65 MasterTikka M65ASpecificationsMass3.1 kg (Tr...

This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Just Dance Kids 2010 video game – news · newspapers · books · scholar · JSTOR (January 2022) (Learn how and when to remove this template message) 2010 video gameJust Dance KidsNorth American box artDeveloper(s)Land Ho!Publisher(s)UbisoftSeriesJust DancePla...

German politician (1896–1959) This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Franz Blücher – news · newspapers · books · scholar · JSTOR (December 2012) (Learn how and when to remove this template message) Franz BlücherVice-Chancellor of West GermanyIn office20 September 1949 – 29 October 195...

You can help expand this article with text translated from the corresponding article in French. (March 2012) Click [show] for important translation instructions. View a machine-translated version of the French article. Machine translation, like DeepL or Google Translate, is a useful starting point for translations, but translators must revise errors as necessary and confirm that the translation is accurate, rather than simply copy-pasting machine-translated text into the English Wikipedi...

Species of butterfly Krueper's small white both in Bulgaria Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Arthropoda Class: Insecta Order: Lepidoptera Family: Pieridae Genus: Pieris Species: P. krueperi Binomial name Pieris krueperiStaudinger, 1860[1] Synonyms Pieris krueperi var. vernalis Staudinger, 1870 Pieris krueperi, the Krueper's small white, is a butterfly in the family Pieridae. It is found on the Balkan Peninsula and in Iran, Baluchistan, the Kop...

1952 film by Lewis R. Foster Hong KongTheatrical release posterDirected byLewis R. FosterScreenplay byWinston MillerStory byLewis R. FosterProduced byWilliam H. PineWilliam C. ThomasStarringRonald ReaganRhonda FlemingNigel BruceMarvin MillerMary SomervilleLowell GilmoreCinematographyLionel LindonEdited byHoward A. SmithMusic byLucien CaillietProductioncompanyPine-Thomas ProductionsDistributed byParamount PicturesRelease date January 12, 1952 (1952-01-12) Running time94 minutesC...

2019 single by Yella Beezy featuring Chris Brown Restroom OccupiedSingle by Yella Beezy featuring Chris Brownfrom the album Baccend Beezy ReleasedJuly 19, 2019Recorded2019GenreTrapR&BLength3:36LabelHitcoSongwriter(s)Deandre Conway, Christopher BrownProducer(s)Chrishan, OG ParkerYella Beezy singles chronology Rich MF (2019) Restroom Occupied (2019) Ay Ya Ya Ya (2019) Chris Brown singles chronology Blow My Mind(2019) Restroom Occupied(2019) Did You(2019) Restroom Occupied is a song ...

See also: List of Armenian monarchs and List of monarchs of the Armenian Kingdom of Cilicia Queen Erato of the Artaxiad dynasty King Rhadamistus killing Queen Zenobia, by Luigi Sabatell. This is a list of Armenian royal consorts. Kingdom of Armenia Ancient Armenian queens Rodogune of Persia, daughter of King Artaxerxes of Persia, wife of Orontes II Antiochis, sister of Antiochus III the Great, wife of Xerxes Satenik of the Alans, daughter of the king of the Alans, wife of Artaxias I Cleopatra...

National Organisation for Squash in Hong Kong Hong Kong SquashSportSquashAbbreviationHKSFounded1961Regional affiliationAsian Squash FederationLocationHong KongChairmanDavid MuiCEOKarl MakSecretaryTony KwokCoachTony ChoiOfficial websitewww.hksquash.org.hk Hong Kong Squash (HKS) is the National Organisation for Squash in Hong Kong. Mission Statement : To ensure that squash remains a strong, viable and growing Hong Kong sport and that Hong Kong aspires to be the leaders of Squash in Asia. O...