ARID3A

ARID3A
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ARID3A, BRIGHT, DRIL1, DRIL3, E2FBP1, AT-rich interaction domain 3A
Зовнішні ІД OMIM: 603265 MGI: 1328360 HomoloGene: 124247 GeneCards: ARID3A
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005224
NM_001288625
NM_001288626
NM_007880
RefSeq (білок)
NP_005215
NP_001275554
NP_001275555
NP_031906
Локус (UCSC) Хр. 19: 0.93 – 0.98 Mb Хр. 10: 79.76 – 79.79 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ARID3A (англ. AT-rich interaction domain 3A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 593 амінокислот, а молекулярна маса — 62 889[4].

Послідовність амінокислот
1020304050
MKLQAVMETLLQRQQRARQELEARQQLPPDPPAAPPGRARAAPDEDREPE
SARMQRAQMAALAAMRAAAAGLGHPASPGGSEDGPPGSEEEDAAREGTPG
SPGRGREGPGEEHFEDMASDEDMKPKWEEEEMEEDLGEDEEEEEEDYEDE
EEEEDEEGLGPPGPASLGTTALFPRKAQPPQAFRGDGVPRVLGGQERPGP
GPAHPGGAAHVAPQLQPPDHGDWTYEEQFKQLYELDGDPKRKEFLDDLFS
FMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKG
LNLPTSITSAAFTLRTQYMKYLYPYECEKRGLSNPNELQAAIDSNRREGR
RQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKE
EDSAIPITVPGRLPVSLAGHPVVAAQAAAVQAAAAQAAVAAQAAALEQLR
EKLESAEPPEKKMALVADEQQRLMQRALQQNFLAMAAQLPMSIRINSQAS
ESRQDSAVNLTGTNGSNSISMSVEINGIMYTGVLFAQPPAPTPTSAPNKG
GGGGGGSSSNAGGRGGNTGTSGGQAGPAGLSTPSTSTSNNSLP

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Kim D., Probst L., Das C., Tucker P.W. (2007). REKLES is an ARID3-restricted multifunctional domain. J. Biol. Chem. 282: 15768—15777. PMID 17400556 DOI:10.1074/jbc.M700397200

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:3031 (англ.) . Процитовано 12 вересня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, Q99856 (англ.) . Архів оригіналу за 10 листопада 2016. Процитовано 12 вересня 2017.

Див. також

Read other articles:

10-я танковая дивизиянем. 10. Panzerdivision Эмблема 10-й танковой дивизии Страна  Германия Сайт bundeswehr.de/de/organis…  Медиафайлы на Викискладе 10-я танковая дивизия (нем. 10. Panzerdivision) — механизированное соединение Сухопутных войск Германии, штаб дивизии дислоцируется в Файтсхё...

Die Kapelle im Jahre 1976 Die Kapelle im Jahre 2008 Die Dreifaltigkeitskapelle steht am Ortsrand von Jakobwüllesheim, einem Ortsteil der Gemeinde Vettweiß im Kreis Düren, Nordrhein-Westfalen. Inhaltsverzeichnis 1 Bauwerk 2 Ausstattung 3 Prozessionen 4 Weblinks Bauwerk Die Kapelle ist aus Ziegelsteinen gemauert. Das Dach ist mit Schiefer gedeckt. Das Bauwerk hat einen Durchmesser von sechs Metern. Es steht direkt am Ortseingang von Jakobwüllesheim an der Kreisstraße 33 von Vettweiß her k...

Haus Coburg vom Hof aus gesehen (2010) Das Haus Coburg – Städtische Galerie Delmenhorst ist eine Institution für internationale Kunst des 20. und 21. Jahrhunderts. Es bietet wechselnde Einzel- und Gruppenausstellungen sowie Präsentationen der Sammlung zeitgenössischer Kunst im Sinne der Kunstvermittlung.[1] Es befindet sich in der Fischstraße 30 in Delmenhorst-Mitte. Das Bauwerk ist ein Baudenkmal in Delmenhorst. Inhaltsverzeichnis 1 Geschichte 2 Sammlungen 3 Leitung der S...

Sam Hird Adrian Samuel Hird (7 de septiembre de 1987) es un entrenador de fútbol inglés y ex futbolista profesional que es entrenador del primer equipo en el Bolton Wanderers de la EFL League One . Como jugador, fue defensa central o mediocampista defensivo y, sobre todo, tuvo largas temporadas tanto en el Doncaster Rovers como en el Chesterfield . También jugó para Grimsby Town, Alfreton Town y Barrow . Carrera de juego Leeds United Nacido en Norton, Doncaster, South Yorkshire, Hird firm...

Дев'ять життів кота ФріцаThe Nine Lives of Fritz the Cat Жанр анімація, чорна комедія (18+)Режисер Роберт ТейлорПродюсер Steve KrantzdКомпозитор Tom ScottdКінокомпанія American International PicturesdДистриб'ютор American International PicturesТривалість 1:16:30Мова англійськаКраїна  СШАРік 1974Кошторис $1.5 млн.IMDb ID 0071913Попе

Beaurains-lès-Noyon Entidad subnacional Beaurains-lès-NoyonLocalización de Beaurains-lès-Noyon en Francia Coordenadas 49°36′39″N 2°58′22″E / 49.610833333333, 2.9727777777778Entidad Comuna de Francia • País  Francia • Región Picardía • Departamento Oise • Distrito distrito de Compiègne • Cantón cantón de Noyon • Mancomunidad Communauté de communes du Pays NoyonnaisAlcalde Daniel Hardier(2008 - 2014)Superficie &...

Delias kristianiae TaksonomiKerajaanAnimaliaFilumArthropodaKelasInsectaOrdoLepidopteraFamiliPieridaeTribusPieriniGenusDeliasSpesiesDelias kristianiae lbs Delias kristianiae adalah sebuah spesies kupu-kupu Papua langka yang diambil dari nama Ibu Negara Indonesia Kristiani Herawati. Kristiani Herawati dipersembahkan oleh Conservation International dengan sebuah spesimen dari D. kristianiae setelah spesies tersebut dinamai, yang disumbangkan ke sebuah museum.[1] Referensi Wikimedia Commo...

Міст султана Сулеймана Величного Названо на честь Сулейман I Пишний Країна  Туреччина[1] Адміністративна одиниця Стамбул Дата офіційного відкриття 1567 Інженер-будівельник Сінан Проходить над/під Бююкчекмедже (озеро) Довжина або відстань 635,57 м  Міст султана Сул

School in Cuyahoga Falls, Ohio, United StatesWalsh Jesuit High SchoolLocation4550 Wyoga Lake RoadCuyahoga Falls, Ohio 44224-1059United StatesCoordinates41°11′33″N 81°29′46″W / 41.19250°N 81.49611°W / 41.19250; -81.49611InformationTypePrivate, coeducational, college preparatoryMottoMen and Women for and with OthersReligious affiliation(s)Roman Catholic (Jesuit)Established1964; 59 years ago (1964)PresidentGary FronkChairmanThomas HaagPrincip...

There Will Be BloodPoster film There Will Be BloodSutradara Paul Thomas Anderson Produser Paul Thomas Anderson Daniel Lupi JoAnne Sellar Ditulis oleh Paul Thomas Anderson SkenarioPaul Thomas AndersonBerdasarkanOil!oleh Upton SinclairPemeranDaniel Day-LewisPaul DanoKevin J. O'ConnorCiarán HindsDillon FreasierPenata musikJonny GreenwoodSinematograferRobert ElswitPenyuntingDylan TichenorPerusahaanproduksiGhoulardi Film CompanyDistributorMiramax FilmsParamount VantageTanggal rilis 27 Septe...

American college football season 2022 Boston College Eagles footballConferenceAtlantic Coast ConferenceDivisionAtlantic DivisionRecord3–9 (2–6 ACC)Head coachJeff Hafley (3rd season)Offensive coordinatorJohn McNulty (1st season)Offensive schemePro spreadDefensive coordinatorTem Lukabu (3rd season)Base defense4–3Home stadiumAlumni Stadium(capacity: 44,500)Seasons← 20212023 → 2022 Atlantic Coast Conference football standings vte Conf Over...

Император Мексики Императорский герб (1863—1867) Maксимилиан I Должность Форма обращения Ваше величество Появилась 19 мая 1822 Первый Aгустин I Последний Максимилиан I Упразднена 15 Maя 1867 Император Мексики (исп. Emperador de México) — титул монарха, главы государства Мексики. Титул учре...

Historic district in Michigan, United States United States historic placeIsland Historic DistrictU.S. National Register of Historic PlacesU.S. Historic district Main Street looking south from Bridge, circa 1907Show map of MichiganShow map of the United StatesLocationRoughly bounded by Hill St., Anderson St., the mill race, Park St., Bannister St. and the Kalamazoo R., Plainwell, MichiganCoordinates42°26′26″N 85°38′24″W / 42.44056°N 85.64000°W / 42.44056; -8...

Upper portion of the human body This article is about human anatomy. For the game developer, see Human Head Studios. For other uses, see Head (disambiguation). Human headThe human head drawn by Leonardo da VinciDetailsIdentifiersLatincaputMeSHD006257TA98A01.1.00.001TA298FMA7154Anatomical terminology[edit on Wikidata] In human anatomy, the head is at the top of the human body. It supports the face and is maintained by the skull, which itself encloses the brain. Structure Anatomy of the hum...

Dies ist eine Liste der Premierminister Litauens, der Leiter der Regierung Litauens. Inhaltsverzeichnis 1 1918–1940 2 Ab 1990 3 Siehe auch 4 Weblinks 1918–1940 Premierminister # Bild Name Lebensdaten Amtsantritt Amtsaustritt Partei 1 Augustinas Voldemaras 1883–1942 11. November 1918 26. Dezember 1918 TPP 2 Mykolas Sleževičius 1882–1939 26. Dezember 1918 12. März 1919 LVS 3 Pranas Dovydaitis 1886–1942 12. März 1919 12. April 1919 LKDP (2) Mykolas Sleževičius 1882–1939 12. Apr...

American legislative district Pennsylvania's 159th StateHouse of RepresentativesdistrictRepresentative  Carol KazeemD–Chester Demographics38.61% White54.57% Black6.70% HispanicPopulation (2011) • Citizens of voting age60,27043,931 The 159th Pennsylvania House of Representatives District is located in Delaware County. The 159th District lies in the Southeast part of the state. It has been represented by Carol Kazeem since 2022. District profile Delawa...

  1988 Yugoslavian Grand PrixRace detailsRace 10 of 15 races in the1988 Grand Prix motorcycle racing seasonDate17 July 1988Official nameYu Grand Prix[1][2][3]LocationAutomotodrom RijekaCoursePermanent racing facility4.168 km (2.590 mi)500 ccPole positionRider Christian Sarron YamahaTime 1:30.176 Fastest lapRider Christian Sarron YamahaTime 1:30.569 PodiumFirst Wayne Gardner HondaSecond Christian Sarron YamahaThird Wayne Rainey Yamaha250 ccPole posit...

One of the seven princes of Hell in demonology This article is about the demon. For the Austrian band, see Belphegor (band). For other uses, see Belphegor (disambiguation). BelphegorSlothBelphegor illustration from the Dictionnaire Infernal. Belphegor by Jean Jacques Flipart In Christian demonology, Belphegor or Baal-Peor (Hebrew: בַּעַל-פְּעוֹר Baʿal-Pəʿōr, lord of the gap) is a demon. In later Kabbalah Belphegor is a demon who helps people make discoveries. He seduces peopl...

Kyoto Botanical Gardens京都府立植物園LocationSakyō-ku, Kyoto, JapanCoordinates35°02′54″N 135°45′40″E / 35.04833°N 135.76111°E / 35.04833; 135.76111Area24 hectares (59 acres)EstablishedJanuary 1, 1924 (1924-01-01)Operated byKyoto Prefecture GovernmentVisitors882,524 (in 2015)[1]Open9am-5pm (Last entry at 4pm)StatusClosed from December 28 to January 4Species12,000Public transit accessKitayama Station (Kyoto Municip...

Tethys. Tethys adalah sebuah satelit alami Saturnus yang ditemukan oleh Giovanni Domenico Cassini tahun 1684.[1] Nama Tethys berasal dari mitologi Yunani. Satelit ini juga disebut Saturnus III atau S III Tethys. Cassini menamai 4 bulan yang ia temukan tahun 1671–1684 (Tethys, Dione, Rhea dan Iapetus) Sidera Lodoicea (bintang Louis) untuk menghormati Raja Louis XIV dari PrancisLouis XIV. Etimologi Kata Tethys berasal dari mitologi yunani yaitu Tethis,Seorang dewi laut yunani. Re...