ATF1

ATF1
Ідентифікатори
Символи ATF1, EWS-FUS/ATF-1, TREB36, activating transcription factor 1
Зовнішні ІД OMIM: 123803 MGI: 3037720 HomoloGene: 3790 GeneCards: ATF1
Пов'язані генетичні захворювання
Angiomatoid fibrous histiocytoma[1]
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005171
XM_036162179
RefSeq (білок)
NP_005162
н/д
Локус (UCSC) Хр. 12: 50.76 – 50.82 Mb Хр. X: 52.89 – 52.89 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ATF1 (англ. Activating transcription factor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 271 амінокислот, а молекулярна маса — 29 233[5].

Послідовність амінокислот
1020304050
MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGS
SQKAHGILARRPSYRKILKDLSSEDTRGRKGDGENSGVSAAVTSMSVPTP
IYQTSSGQYIAIAPNGALQLASPGTDGVQGLQTLTMTNSGSTQQGTTILQ
YAQTSDGQQILVPSNQVVVQTASGDMQTYQIRTTPSATSLPQTVVMTSPV
TLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKEYVKCLENRVAVLEN
QNKTLIEELKTLKDLYSNKSV

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Hai T., Liu F., Coukos W.J., Green M.R. (1989). Transcription factor ATF cDNA clones: an extensive family of leucine zipper proteins able to selectively form DNA-binding heterodimers. Genes Dev. 3: 2083—2090. PMID 2516827 DOI:10.1101/gad.3.12b.2083
  • Waters B.L., Panagopoulos I., Allen E.F. (2000). Genetic characterization of angiomatoid fibrous histiocytoma identifies fusion of the FUS and ATF-1 genes induced by a chromosomal translocation involving bands 12q13 and 16p11. Cancer Genet. Cytogenet. 121: 109—116. PMID 11063792 DOI:10.1016/S0165-4608(00)00237-5
  • Sun P., Lou L., Maurer R.A. (1996). Regulation of activating transcription factor-1 and the cAMP response element-binding protein by Ca2+/calmodulin-dependent protein kinases type I, II, and IV. J. Biol. Chem. 271: 3066—3073. PMID 8621702 DOI:10.1074/jbc.271.6.3066
  • Hailemariam K., Iwasaki K., Huang B.W., Sakamoto K., Tsuji Y. (2010). Transcriptional regulation of ferritin and antioxidant genes by HIPK2 under genotoxic stress. J. Cell Sci. 123: 3863—3871. PMID 20980392 DOI:10.1242/jcs.073627
  • Yoshimura T., Fujisawa J., Yoshida M. (1990). Multiple cDNA clones encoding nuclear proteins that bind to the tax-dependent enhancer of HTLV-1: all contain a leucine zipper structure and basic amino acid domain. EMBO J. 9: 2537—2542. PMID 2196176

Примітки

  1. Захворювання, генетично пов'язані з ATF1 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:783 (англ.) . Процитовано 11 вересня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  5. UniProt, P18846 (англ.) . Архів оригіналу за 1 вересня 2017. Процитовано 11 вересня 2017.

Див. також

Read other articles:

Ikatan Psikolog Klinis Indonesia (IPK Indonesia) merupakan organisasi profesi psikologi teraktif dan terbesar di Indonesia dengan jumlah anggota aktif mencapai lebih dari 2800 psikolog klinis dan anggota terdaftar mencapai lebih dari 3700 psikolog klinis. Organisasi ini menjadi wadah bagi tenaga Psikologi klinis di Indonesia.[1] Ikatan Psikolog Klinis IndonesiaSingkatanIPK IndonesiaTanggal pendirian23 September 2017; 6 tahun lalu (2017-09-23)[2]TipeOrganisasi ProfesiTujua...

هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (مارس 2016) ماجد الحيدر   معلومات شخصية الميلاد سنة 1960 (العمر 62–63 سنة)  بغداد، العراق الجنسية عراقي الحياة العملية المهنة شاعر، مترجم تعديل مصدري - تعديل   ماجد ال

King of Hispania ChintilaImaginary portrait of Chintila by Bernardino Montañés in the Museo del Prado. Oil on canvas, 1855King of HispaniaReign12 March 636 – 20 December, 639PredecessorSisenandSuccessorTulgaBornc. 606Died20 December 639 (aged 33)IssueTulga Chintila (Latin: Chintila, Chintilla, Cintila; c. 606 – 20 December 639) was a Visigothic King of Hispania, Septimania and Galicia from 636.[1] He succeeded Sisenand and reigned until he died of natural causes,[2] ruli...

Village in Kent, England Human settlement in EnglandLeysdown-on-SeaThe sea wall to the east of LeysdownLeysdown-on-SeaLocation within KentArea1.055 km2 (0.407 sq mi)Population936 (2020 estimate)• Density887/km2 (2,300/sq mi)OS grid referenceTR 034 704Civil parishLeysdownDistrictSwaleShire countyKentRegionSouth EastCountryEnglandSovereign stateUnited KingdomPost townSHEERNESSPostcode districtME12Dialling code01795PoliceKentFireKentA...

British-American journalist and broadcaster For the British peer, see Alistair Cooke, Baron Lexden. For the British diplomat, see Alastair Crooke. For the English cricketer, see Alastair Cook. Alistair CookeCooke during an interview in 1974BornAlfred Cooke(1908-11-20)20 November 1908Salford, Lancashire, EnglandDied30 March 2004(2004-03-30) (aged 95)New York City, U.S.CitizenshipUnited Kingdom (until 1941)United States (from 1941)Alma materJesus College, CambridgeYale UniversityHarva...

Full-frame mirrorless interchangeable-lens camera Canon EOS R6EOS R6+RF85 mm F2.0 MACRO IS STMOverviewMakerCanon Inc.TypeMirrorless interchangeable lens cameraReleasedJuly 09, 2020Intro price$2,499.00 (body only)$2,899 (with RF 24-105 F4-7.1 IS STM)$3,599 (with RF 24-105 F4 L IS USM)LensLens mountCanon RFSensor/mediumSensordual-pixel CMOS sensorSensor size36 mm × 24 mm (Full frame)Maximum resolution5472 × 3648 pixels (6.56 μm pixel size) (20.1 MP)Film speedISO 100 ...

La Iglesia católica es una de las dos principales denominaciones cristianas en Alemania. Está organizada en 27 diócesis.[1]​ Según la Conferencia Episcopal Alemana, en 2019 el número de miembros era de 36,126,160, lo que correspondía al 43,4% de la población total. En 2016, el 53% de los católicos eran mujeres y el 47% hombres.[2]​ Aunque la Iglesia católica es global en su denominación (la antigua palabra griega katholikos significa universal) y no forma iglesias nacion...

An 1888 illustration of Esmond James William Esmond (11 April 1822 – 3 December 1890) was an Irish-Australian gold prospector and miner, and was one of the first people to discover gold in Australia. Early life Esmond was born in Enniscorthy, a town in County Wexford in the south-east of Ireland, in 1822, the son of a merchant.[1] Migrating to the Port Phillip District (later the colony of Victoria) in 1840, Esmond worked a number of jobs, including working on stations in the We...

STXBP5 المعرفات الأسماء المستعارة STXBP5, Tomosyn, LGL3, LLGL3, Nbla04300, syntaxin binding protein 5 معرفات خارجية الوراثة المندلية البشرية عبر الإنترنت 604586 MGI: MGI:1926058 HomoloGene: 16402 GeneCards: 134957 علم الوجود الجيني الوظيفة الجزيئية • ‏GO:0005097، ‏GO:0005099، ‏GO:0005100 GTPase activator activity• syntaxin-1 binding• syntaxin binding• myosin II binding المكو...

This article is an orphan, as no other articles link to it. Please introduce links to this page from related articles; try the Find link tool for suggestions. (October 2020) Traditional instrument accompanied by song and dance Mbiwi are bamboo claves that Mayotte women clash to a particular rhythm, and accompany with singing[1] and dance, traditionally practiced on the island of Mayotte, where it is reserved exclusively for women.[2] The mbiwi[3] begins when a mother f...

Peaked cotton cap worn by racing cyclists Jean-Claude Lebaube wearing a casquette in 1964 A casquette (from French 'cap') is a peaked cotton cap traditionally worn by road cyclists.[1] With the introduction of compulsory cycle helmets for massed-start racing, casquettes have become less common, but most professional race outfits still have them produced in team colours for wearing on the winners' podium, for wearing under a helmet in heavy rain or for sale to the tifosi. They...

Third-century Christian apologetics work by Origen of Alexandria Greek text of Origen's apologetic treatise Contra Celsum, which is considered to be the most important work of early Christian apologetics[1][2] Against Celsus (Greek: Κατὰ Κέλσου, Kata Kelsou; Latin: Contra Celsum), preserved entirely in Greek, is a major apologetics work by the Church Father Origen of Alexandria, written in around 248 AD, countering the writings of Celsus, a pagan philosopher and con...

قرية السرب  - قرية -  تقسيم إداري البلد  اليمن المحافظة محافظة المحويت المديرية مديرية ملحان العزلة عزلة القبلة السكان التعداد السكاني 2004 السكان 471   • الذكور 251   • الإناث 220   • عدد الأسر 77   • عدد المساكن 83 معلومات أخرى التوقيت توقيت اليمن (+3 غرينيتش) ...

O míssil Dongfeng 2 O Dongfeng 2 (chinês tradicional: 東風 2, chinês simplificado: 东风 2, lit. ‘Vento Leste 2’) ou DF-2 foi o primeiro míssil balístico de médio alcance fabricado pela República Popular da China. O DF-2 tinha um alcance de 1.250 km para uma ogiva nuclear de 15-20 kt. Ele recebeu a designação de CSS-1 no ocidente.[1] Os especialistas do ocidente, assumiram desde o início, que o DF-2 era uma cópia do míssil soviético R-5 Pobeda (SS-3 Shyster), dev...

12th series in the Kamen Rider franchise Kamen Rider RyukiTitle ScreenGenreTokusatsuSuperhero fictionCreated byShotaro IshinomoriDeveloped byIshimori ProductionsToei CompanyWritten byYasuko KobayashiToshiki InoueDirected byRyuta TasakiHidenori IshidaTakao NagaishiTakemitsu SatōNobuhiro SuzumuraStarringTakamasa SugaSatoshi MatsudaAyano SugiyamaKenzaburo KikuchiKazue TsunogaeRyoheiTomohisa YugeTakashi HaginoKanji TsudaSayaka KuonHitomi KuriharaChisato MorishitaVoices ofTsuyoshi KoyamaNarrated ...

Emperor of Japan Emperor Go-Murakami後村上天皇Emperor of JapanReignSeptember 18, 1339 – March 29, 1368CoronationNovember 6, 1339PredecessorGo-DaigoSuccessorChōkeiShōgunAshikaga TakaujiAshikaga YoshiakiraBorn1328DiedMarch 29, 1368(1368-03-29) (aged 39–40)BurialHinoo no Misasagi (檜尾陵) (Osaka)Issuemore...Emperor ChōkeiEmperor Go-KameyamaPosthumous nameTsuigō:Emperor Go-Murakami (後村上院 or 後村上天皇)HouseYamatoFatherEmperor Go-DaigoMotherFujiwara no RenshiSigna...

Ishtar TVTypeSatellite television networkCountryIraqAvailabilityMiddle EastOwnerChaldean Syriac Assyrian Popular CouncilKey peopleSarkis Aghajan MamendoLaunch date2005 (2005)Official websitewww.ishtartv.com Ishtar TV (Syriac: ܥܫܬܪ, after the Assyro-Babylonian goddess, Ishtar) is an Assyrian broadcasting channel which has its headquarters in Ankawa, Iraq. It was established by Sarkis Aghajan and was led by George Mansour, who was Ishtar TV's first General Manager, in 2005. The network...

У этого термина существуют и другие значения, см. Берн (значения). КантонБерннем. Bernфр. Berne Флаг Герб 46°50′ с. ш. 07°37′ в. д.HGЯO Страна Швейцария Включает 10 округов Адм. центр Берн Глава Беатриса Зимон[d][1] История и география Дата образования 1353 Площадь 5958,51&...

Historic district in Nebraska, United States United States historic placeGold Coast Historic DistrictU.S. National Register of Historic PlacesU.S. Historic district Joslyn Castle, a landmark in Omaha's Gold Coast.Show map of NebraskaShow map of the United StatesLocationOmaha, NebraskaArea138 acres (56 ha)Built1889ArchitectmultipleArchitectural styleColonial Revival, Tudor Revival, Queen AnneNRHP reference No.97000237[1]Added to NRHPMarch 14, 1997 The Gold Coast His...

Отцы-основатели: Отцы-основатели Европейского союза Список основателей Канадской конфедерации Отцы-основатели США  Национальные символы (списки[en])Основные темы Блюдо[en] Бог[en] Герб[en] Государственные символы Миф Отец нации[en] Персонификация[en] Поэзия[en] поэт[en] эпос[en] ...