NR5A2

NR5A2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NR5A2, B1F, B1F2, CPF, FTF, FTZ-F1, FTZ-F1beta, LRH-1, LRH1, hB1F-2, nuclear receptor subfamily 5 group A member 2
Зовнішні ІД OMIM: 604453 MGI: 1346834 HomoloGene: 20827 GeneCards: NR5A2
Пов'язані генетичні захворювання
рак підшлункової залози[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001276464
NM_003822
NM_205860
NM_001159769
NM_030676
RefSeq (білок)
NP_001263393
NP_003813
NP_995582
NP_001153241
NP_109601
Локус (UCSC) Хр. 1: 200.03 – 200.18 Mb Хр. 1: 136.77 – 136.89 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NR5A2 (англ. Nuclear receptor subfamily 5 group A member 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 541 амінокислот, а молекулярна маса — 61 331[5].

Послідовність амінокислот
1020304050
MSSNSDTGDLQESLKHGLTPIGAGLPDRHGSPIPARGRLVMLPKVETEAL
GLARSHGEQGQMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGL
LTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRCPYCRFQKCLSVG
MKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVI
QAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMP
PHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPAS
IPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMAD
QTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKE
GSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVC
LKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLL
LRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKRA

Кодований геном білок за функцією належить до рецепторів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ліпідами, іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література

  • Nitta M., Ku S., Brown C., Okamoto A.Y., Shan B. (1999). CPF: an orphan nuclear receptor that regulates liver-specific expression of the human cholesterol 7alpha-hydroxylase gene. Proc. Natl. Acad. Sci. U.S.A. 96: 6660—6665. PMID 10359768 DOI:10.1073/pnas.96.12.6660
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Galarneau L., Drouin R., Belanger L. (1998). Assignment of the fetoprotein transcription factor gene (FTF) to human chromosome band 1q32.11 by in situ hybridization. Cytogenet. Cell Genet. 82: 269—270. PMID 9858833

Примітки

  1. Захворювання, генетично пов'язані з NR5A2 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:7984 (англ.) . Процитовано 25 серпня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  5. UniProt, O00482 (англ.) . Архів оригіналу за 22 липня 2017. Процитовано 25 серпня 2017.

Див. також

Read other articles:

Селище Ловер-Макангі Тауншипангл. Lower Macungie Township Координати 40°32′51″ пн. ш. 75°33′58″ зх. д. / 40.54750000002777455° пн. ш. 75.56611111113878110° зх. д. / 40.54750000002777455; -75.56611111113878110Координати: 40°32′51″ пн. ш. 75°33′58″ зх. д. / 40.54750000002777455° пн. ш. 75.566111...

Герб Нікополя ДеталіНосій НікопольЗатверджений 28 листопада 2000Щит іспанськийОснова синій щитІнші елементи козак Герб Ні́кополя — один із символів міста Нікополь Дніпропетровської області, затверджений 28 листопада 2000 року рішенням Нікопольської міської ради. Автор...

Orquesta La Solución de Puerto Rico Orquesta La Solución en una presentación a fines de la década del 70.Datos generalesOrigen Mayagüez, Puerto RicoEstado ActivoInformación artísticaOtros nombres El Original de Puerto RicoGénero(s) Salsa románticaPeríodo de actividad 1974 - presenteDiscográfica(s) Rodven Records [editar datos en Wikidata] Orquesta La Solución es un grupo musical de salsa, originaria de Mayagüez, Puerto Rico y creada por el bajista Roberto Rive...

1991 studio album by Cop Shoot CopWhite NoiseStudio album by Cop Shoot CopReleased1991RecordedJune 1991 (1991-06)StudioBC Studio, Brooklyn, NYGenre Noise rock industrial rock Length39:58LabelBig CatProducerMartin BisiCop Shoot Cop chronology Consumer Revolt(1990) White Noise(1991) Suck City(1992) White Noise is the second album by the American noise rock group Cop Shoot Cop, released in 1991 by Big Cat.[1] The band supported the album with a North American tour.[...

American attack aircraft A-17 / Nomad Northrop A-17 Role Ground attackType of aircraft Manufacturer Northrop Designer Jack Northrop Introduction 1935 Primary users United States Army Air CorpsSwedish Air Force South African Air Force Royal Canadian Air Force Number built 411 Developed from Northrop Gamma Variants Douglas A-33 The Northrop A-17, also known as the Northrop Model 8, a development of the Northrop Gamma 2F model, was a two-seat, single-engine, monoplane, attack bomber built i...

BirdramonChampionPenampilan perdanaDigimon Adventure Episode 4[1]PartnerSora TakenouchiEvolusi dariBiyomonBerevolusi menjadiGarudamon Tingkatan evolusiBiyomon Level In-Training Yokomon Level Rookie Biyomon Level Champion Birdramon Level Ultimate Garudamon DigiDestined: Sora Takenouchilbs Birdramon merupakan salah satu digimon yang menjadi peran utama dalam Digimon Adventure dan Digimon Adventure 02. Birdramon diambil dari kata bird yang berarti burung, dan desain dari digimon ini berb...

الهلال الأحمر العربي السوري الهلال الأحمر العربي السوري‌ الاختصار SARC البلد سوريا  المقر الرئيسي دمشق تاريخ التأسيس 1942 النوع منظمة غير حكومية الاهتمامات إنسانية منطقة الخدمة  سوريا العضوية الاتحاد الدولي لجمعيات الصليب الأحمر والهلال الأحمر  الألوان الأحمر والأ...

Gdynia ArenaPolsat Plus Arena GdyniaLocationGdynia, PolandCapacity5,500OpenedDecember 22, 2008TenantsArka Gdynia (basketball) Gdynia Arena (known in Poland as Hala Sportowo-Widowiskowa Gdynia and for sponsorship reasons as the Polsat Plus Arena Gdynia since August 2022) is an indoor arena that is located in Gdynia, Poland. It is the home of the professional Euroleague Basketball club Arka Gdynia. The arena opened on December 22, 2008, and it has a seating capacity of 5,500 for basketball game...

Process of silk production Court Ladies Preparing Newly Woven Silk by Emperor Huizong of Song Sericulture, or silk farming, is the cultivation of silkworms to produce silk. Although there are several commercial species of silkworms, the caterpillar of the domestic silkmoth is the most widely used and intensively studied silkworm. Silk was believed to have first been produced in China as early as the Neolithic period. Sericulture has become an important cottage industry in countries such as Br...

Geographical region in Texas, USA Texas Coastal Bend illustration bordering the Gulf of Mexico The Texas Coastal Bend, or just the Coastal Bend, is a geographical region in the US state of Texas. The name refers to the area being a curve along the Texas Gulf Coast of the Gulf of Mexico. The largest city of the Coastal Bend is Corpus Christi. It includes the Nueces Estuary (Corpus Christi Bay) and the Mission–Aransas Estuary (Aransas Bay), as well as part of Laguna Madre. The coastline is pa...

Ḥussain Shāhīحسين شاهیহুসেন শাহীRoyal houseMap of the Hussain Shahi dynasty of the Bengal Sultanate[1]CountryBengal SultanateCurrent regionBengal, BiharEtymologyName of Alauddin Husain ShahFounded1494 (1494)FounderAlauddin Husain ShahFinal rulerGhiyasuddin Mahmud ShahTitlesSultanMembersNasiruddin Nasrat ShahAlauddin Firuz Shah IISyeda Momena KhatunConnected membersIbrahim Danishmand, Khidr Khan Surak, Isa KhanTraditionsSunni IslamEstate(s)GaurDeposit...

Гаврилюк Олексій ЮхимовичНародився 1923(1923)Помер невідомоКраїна  СРСРНаціональність українецьДіяльність державний діячПартія КПРСНагороди У Вікіпедії є статті про інших людей із прізвищем Гаврилюк. Олексій Юхимович Гаврилюк (1923(1923) — ?) — український радянсь...

Emirates SkyCargo operates dedicated cargo flights to countries across Africa, Asia, Australia, Europe, and the Americas from its hub at Al Maktoum International Airport. The airline also has scheduled cargo flights to 9 destinations, which do not receive service from Emirates passenger aircraft, namely: Djibouti, Eldoret, Guadalajara, Hanoi, Liège, Lilongwe, Ouagadougou, Quito and Zaragoza. Additionally, Emirates SkyCargo manages the cargo holds of all Emirates passenger aircraft, the compa...

2007 video by The Rolling StonesThe Biggest BangVideo by The Rolling StonesReleasedJune 2007 (2007-06)Recorded18 February – 22 October 2006 in Rio de Janeiro, Brazil; Buenos Aires, Argentina; Saitama, Japan; Shanghai, China; Austin, Texas, United StatesGenreRockLabelRedline EntertainmentDirectorHamish Hamilton, J. B. De Oliveira, Toru Uehara, Wang Xianshen, Fernando Rolan, Jacob Cohl, Anthony GreenProducerThe Rolling Stones, Done and Dusted, Marty Callner, Randall Gladstei...

Museum Nasional IndonesiaMuseum Nasional Republik IndonesiaDidirikan24 April 1778[1]LokasiJl. Medan Merdeka Barat No. 12Kelurahan Gambir, Kecamatan GambirJakarta Pusat 10110JenisMuseum ilmu pengetahuanAkses transportasi umumBRT Transjakarta: 1 2 2A 2D 6A 6B 7 9B (halte Monumen Nasional)Bus Kota Transjakarta:1A, 1P, 5A, DA4, GR1KAI Commuter: L R (stasiun Tanah Abang)Situs webhttp://www.museumnasional.or.id/ Cagar budaya IndonesiaGedung Museum NasionalPeringkatNasionalKategoriBangunanNo...

Upazila in Dhaka, BangladeshCharbhadrasan চরভদ্রাসনUpazilaSkyline of Charbhadrasan, Faridpur, Bangladesh (clockwise from top):Central Shaheed Minar, Charbhadrasan Central Masque, Charbhadrasan Pilot High School, Jute Field, Gopalpur Ghat of Padma, Charbhadrasan Govt. College, Upazila Nirbahi Officer’s Office.Coordinates: 23°33.5′N 90°5′E / 23.5583°N 90.083°E / 23.5583; 90.083Country BangladeshDivisionDhakaDistrictFaridpurEstablishment19...

American progressive magazine For other uses, see Mother Jones (disambiguation). Mother JonesMay/June 2010 coverEditor-in-ChiefClara JefferyCategoriesPoliticsFrequencyBi-monthlyFirst issueFebruary 1976; 47 years ago (1976-02)CountryUnited StatesBased inSan Francisco, California, U.S.LanguageEnglishWebsitewww.motherjones.comISSN0362-8841 Mother Jones (abbreviated MoJo) is a nonprofit American progressive[1][2] magazine that focuses on news, commentar...

Al-Juarismi Información personalNombre nativo أبو عبد الله محمد بن موسى الخوارزمي ابو جعفرOtros nombres Abu Yāffar AlgorithmiNacimiento circa 780Corasmia, Califato abasíFallecimiento circa 850(70 años)Bagdad, Califato abasíResidencia Bagdad Religión SunismoInformación profesionalOcupación Matemático, astrónomo, geógrafo, filósofo, escritorAños activo 813-846Empleador Casa de la sabiduríaLengua literaria Árabe y persaObras notables Compen...

Este artículo o sección necesita referencias que aparezcan en una publicación acreditada.Este aviso fue puesto el 17 de julio de 2011. Pascual Cucala Información personalNacimiento 1822 Alcalá de Chivert (España) Fallecimiento 31 de enero de 1892 Port-Vendres (Francia) Nacionalidad EspañolaInformación profesionalOcupación Militar Conflictos Tercera Guerra Carlista [editar datos en Wikidata] Pascual Cucala Mir (Alcalá de Chivert, 1822 - Port-Vendres, 31 de enero de 1892) fu...

Wakil Bupati Aceh BesarPetahanaTidak adasejak 14 Juli 2022Masa jabatan5 tahunDibentuk2007Pejabat pertamaH. Anwar Ahmad, S.E., Ak.Situs webwww.acehbesarkab.go.id Berikut ini adalah daftar Wakil Bupati Aceh Besar dari masa ke masa. No Wakil Bupati Mulai Jabatan Akhir Jabatan Prd. Ket. Bupati 1 H.Anwar AhmadS.E., Ak. 1 Maret 2007 1 Maret 2012 1   Dr. H.Bukhari DaudM.Ed. Jabatan kosong 1 Maret 2012 8 Maret 2012 -   Zulkifli Ahmad(Pelaksana Harian) 8 Maret 2012 3 Juli 2012   Zu...