NR5A2

NR5A2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NR5A2, B1F, B1F2, CPF, FTF, FTZ-F1, FTZ-F1beta, LRH-1, LRH1, hB1F-2, nuclear receptor subfamily 5 group A member 2
Зовнішні ІД OMIM: 604453 MGI: 1346834 HomoloGene: 20827 GeneCards: NR5A2
Пов'язані генетичні захворювання
рак підшлункової залози[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001276464
NM_003822
NM_205860
NM_001159769
NM_030676
RefSeq (білок)
NP_001263393
NP_003813
NP_995582
NP_001153241
NP_109601
Локус (UCSC) Хр. 1: 200.03 – 200.18 Mb Хр. 1: 136.77 – 136.89 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NR5A2 (англ. Nuclear receptor subfamily 5 group A member 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 541 амінокислот, а молекулярна маса — 61 331[5].

Послідовність амінокислот
1020304050
MSSNSDTGDLQESLKHGLTPIGAGLPDRHGSPIPARGRLVMLPKVETEAL
GLARSHGEQGQMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGL
LTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRCPYCRFQKCLSVG
MKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVI
QAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMP
PHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPAS
IPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMAD
QTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKE
GSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVC
LKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLL
LRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKRA

Кодований геном білок за функцією належить до рецепторів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ліпідами, іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література

  • Nitta M., Ku S., Brown C., Okamoto A.Y., Shan B. (1999). CPF: an orphan nuclear receptor that regulates liver-specific expression of the human cholesterol 7alpha-hydroxylase gene. Proc. Natl. Acad. Sci. U.S.A. 96: 6660—6665.  PMID 10359768 DOI:10.1073/pnas.96.12.6660
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004.  PMID 15489334 DOI:10.1101/gr.2596504
  • Galarneau L., Drouin R., Belanger L. (1998). Assignment of the fetoprotein transcription factor gene (FTF) to human chromosome band 1q32.11 by in situ hybridization. Cytogenet. Cell Genet. 82: 269—270.  PMID 9858833

Примітки

  1. Захворювання, генетично пов'язані з NR5A2 переглянути/редагувати посилання на ВікіДаних. 
  2. Human PubMed Reference:. 
  3. Mouse PubMed Reference:. 
  4. HUGO Gene Nomenclature Commitee, HGNC:7984 (англ.) . Процитовано 25 серпня 2017. {{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  5. UniProt, O00482 (англ.) . Архів оригіналу за 22 липня 2017. Процитовано 25 серпня 2017. 

Див. також

Read other articles:

1 Yohanes 1Akhir dari Surat 2 Petrus (pasal 3:16-18) dan permulaan Surat 1 Yohanes (pasal 1:1-2:9) dalam kolom yang sama, pada Codex Alexandrinus yang diperkirakan dibuat antara tahun 400-440 M.KitabSurat 1 YohanesKategoriSurat-surat AmBagian Alkitab KristenPerjanjian BaruUrutan dalamKitab Kristen23← 2 Petrus 3 pasal 2 → 1 Yohanes 1 (disingkat 1Yoh 1) adalah pasal pertama dari Surat Yohanes yang Pertama dalam Perjanjian Baru di Alkitab Kristen yang digubah oleh Yohanes, salah satu...

 

Girls TripPoster film Girls TripSutradaraMalcolm D. LeeProduserWill PackerMalcolm D. LeeDitulis olehKenya BarrisTracy OliverCeritaErica RivinojaKenya BarrisTracy OliverPemeranRegina HallTiffany HaddishLarenz TateMike ColterKate WalshJada Pinkett SmithQueen LatifahPenata musikDavid NewmanSinematograferGreg GardinerPenyuntingPaul MillspaughPerusahaanproduksiWill Packer ProductionsPerfect World PicturesDistributorUniversal PicturesTanggal rilis 14 Juni 2017 (2017-06-14) (Festival ...

 

Frank Bello (lahir 9 Juli 1965 di Bronx, New York) adalah bassist kelompok musik Anthrax, menggantikan Dan Lilker sejak album Spreading the Disease. Ia hengkang dari Anthrax pada 2004 dan bergabung dengan Helmet, tetapi sekarang telah bergabung kembali. lbsAnthrax Scott Ian Charlie Benante Frank Bello Joey Belladonna Jonathan Donais Dan Lilker Greg D'Angelo Neil Turbin Dan Spitz Matt Fallon John Bush Paul Crook Dan Nelson Rob Caggiano David Weiss John Connelly Paul Kahn Kenny Kushner Greg Wal...

English editor and journalist (1866–1924) For the Canadian-American industrialist of the same name, see Hugh J. Chisholm. Hugh ChisholmChisholm in 1903Born22 February 1866 (1866-02-22)London, EnglandDied29 September 1924(1924-09-29) (aged 58)London, EnglandEducationCorpus Christi College, OxfordOccupation(s)Journalist and encyclopædia editorKnown for10th, 11th, and 12th editions of the Encyclopædia BritannicaRelativesArchibald Chisholm (son) Grace Chisholm (sister) Hugh Chi...

 

American politician (1829–1888) For the Missouri judge, see Roscoe P. Conkling. For the New York lawyer, see Roscoe Seely Conkling. Roscoe ConklingSenator Conkling, c. 1866-68United States Senatorfrom New YorkIn officeMarch 4, 1867 – May 16, 1881Preceded byIra HarrisSucceeded byElbridge LaphamMember of theU.S. House of Representativesfrom New YorkIn officeMarch 4, 1859 – March 3, 1863Preceded byOrsamus MattesonSucceeded byFrancis Kernan (redistricting)Constituenc...

 

This article relies largely or entirely on a single source. Relevant discussion may be found on the talk page. Please help improve this article by introducing citations to additional sources.Find sources: Óscar Osorio – news · newspapers · books · scholar · JSTOR (October 2020) In this Spanish name, the first or paternal surname is Osorio and the second or maternal family name is Hernández. Óscar Osorio32nd President of El SalvadorIn office...

Bushland reserve north of Perth, Western Australia Whiteman ParkWhiteman park swansLocation in PerthLocationWestern AustraliaNearest cityPerthCoordinates31°50′02″S 115°57′54″E / 31.834°S 115.965°E / -31.834; 115.965Area4,000-hectare (9,900-acre; 15 sq mi)Open8:30am–6pmWebsitewww.whitemanpark.com.au See also: Whiteman Park railway station Whiteman Park is a 4,000-hectare (9,900-acre; 15 sq mi) bushland area located 22 km (14&#...

 

Art museum in New York City Not to be confused with the Museum of Modern Art. The Metropolitan Museum of ArtEntrance façades to The Met Fifth Avenue and The CloistersEstablishedApril 13, 1870; 154 years ago (April 13, 1870)[2][3][4]Location1000 Fifth Avenue (The Met Fifth Avenue)99 Margaret Corbin Drive (The Cloisters)New York City, U.S.Coordinates40°46′46″N 73°57′47″W / 40.7794°N 73.9631°W / 40.7794; -73.9631TypeArt mu...

 

National Rail station in London, England Palmers Green Palmers Green StationPalmers GreenLocation of Palmers Green in Greater LondonLocationPalmers GreenLocal authorityLondon Borough of EnfieldManaged byGreat NorthernStation codePALDfT categoryC2Number of platforms2Fare zone4National Rail annual entry and exit2018–19 1.927 million[1]2019–20 1.783 million[1]2020–21 0.464 million[1]2021–22 0.918 million[1]2022–23 1.268 million[1]Key dates1871Ope...

Military academy ADFA redirects here. For the licensed charity, see Australian Doctors for Africa. Australian Defence Force AcademyMottoTo Lead, To ExcelTypeCommonwealth military academyEstablished1986; 38 years ago (1986)AffiliationAustralian Defence ForceAcademic affiliationUNSW SydneyCommandantCommodore Peter LeavyAcademic staff~ 150 Defence~ 380 UniversityUndergraduates~ 950Postgraduates~ 1300LocationCampbell, Canberra, ACT, Australia35°17′38″S 149°09′50″Eþ...

 

Artikel ini perlu diwikifikasi agar memenuhi standar kualitas Wikipedia. Anda dapat memberikan bantuan berupa penambahan pranala dalam, atau dengan merapikan tata letak dari artikel ini. Untuk keterangan lebih lanjut, klik [tampil] di bagian kanan. Mengganti markah HTML dengan markah wiki bila dimungkinkan. Tambahkan pranala wiki. Bila dirasa perlu, buatlah pautan ke artikel wiki lainnya dengan cara menambahkan [[ dan ]] pada kata yang bersangkutan (lihat WP:LINK untuk keterangan lebih lanjut...

 

Bendera Tarija Tarija merupakan sebuah kota yang terletak di Bolivia bagian selatan. Tepatnya di Provinsi Cercado. Pada tahun 2006, kota ini memiliki jumlah penduduk sebesar 170.900 jiwa. Kota ini terletak pada ketinggian 1.854 m. Kota kembar Glasgow, Britania Raya Cannes, Prancis Arica, Chili Pranala luar Situs web resmi Artikel bertopik geografi atau tempat Bolivia ini adalah sebuah rintisan. Anda dapat membantu Wikipedia dengan mengembangkannya.lbs

Voce principale: Venezia Football Club Società Sportiva Dilettantistica. Calcio VeneziaMestreStagione 1987-1988Sport calcio Squadra Venezia-Mestre Allenatore Ferruccio Mazzola Presidente Maurizio Zamparini Serie C22º posto nel girone B. Promosso in Serie C1. Maggiori presenzeCampionato: Dore, Rastelli (34) Miglior marcatoreCampionato: Fiorini, Marchetti (10) 1986-1987 1988-1989 Si invita a seguire il modello di voce Questa pagina raccoglie le informazioni riguardanti il Calcio Venezia...

 

Historic house in Massachusetts, United States United States historic placeBenjamin Abbot HouseU.S. National Register of Historic Places Show map of MassachusettsShow map of the United StatesLocation9 Andover St., Andover, MassachusettsCoordinates42°38′47″N 71°9′11″W / 42.64639°N 71.15306°W / 42.64639; -71.15306Built1711 (1711)NRHP reference No.75000242[1]Added to NRHPFebruary 24, 1975 The Benjamin Abbot House or Abbot Homestead is a ...

 

Sanskrit and Pali word For other uses, see Gana (disambiguation). Not to be confused with Ghana or Gaana. A dancing gana, Deogarh The word gaṇa (/ˈɡʌnə/; Sanskrit: गण) in Sanskrit and Pali means flock, troop, multitude, number, tribe, category, series, or class. It can also be used to refer to a body of attendants and can refer to a company, any assemblage or association of men formed for the attainment of the same aims. The word gana can also refer to councils or assemblies convene...

Italian motorcycle manufacturer This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) This article's tone or style may not reflect the encyclopedic tone used on Wikipedia. See Wikipedia's guide to writing better articles for suggestions. (September 2022) (Learn how and when to remove this message) This article needs additional citations for verification. Please help improve this article by addi...

 

Voce principale: Campionati del mondo di atletica leggera 2023. Mondiali diatletica leggera diBudapest 2023 Corse piane 100 m piani   uomini   donne 200 m piani uomini donne 400 m piani uomini donne 800 m piani uomini donne 1500 m piani uomini donne 5000 m piani uomini donne 10000 m piani uomini donne Corse ad ostacoli 110 / 100 m hs uomini donne 400 m hs uomini donne 3000 m siepi uomini donne Prove su strada Maratona uomini donne Marcia 20 km uomini donne Marcia 35 km uomini donne...

 

1973 UK local government election Map of the results for the 1973 Wigan council election. Labour in red, Conservatives in blue and Independent in grey. The 1973 Wigan Council elections for the First Wigan Metropolitan Borough Council were held on 10 May 1973, with the entirety of the 72 seat council - three seats for each of the 24 wards - up for vote. It was the first council election as the newly formed metropolitan borough under a new constitution. The Local Government Act 1972 stipulated ...

American baseball player (1928-1969) Baseball player Don HoakThird basemanBorn: (1928-02-05)February 5, 1928Roulette Township, Pennsylvania, U.S.Died: October 9, 1969(1969-10-09) (aged 41)Pittsburgh, Pennsylvania, U.S.Batted: RightThrew: RightMLB debutApril 18, 1954, for the Brooklyn DodgersLast MLB appearanceMay 12, 1964, for the Philadelphia PhilliesMLB statisticsBatting average.265Home runs89Runs batted in498 Teams Brooklyn Dodgers (1954–1955) Chicago ...

 

Questa voce sull'argomento calciatori iracheni è solo un abbozzo. Contribuisci a migliorarla secondo le convenzioni di Wikipedia. Segui i suggerimenti del progetto di riferimento. Ahmad Ali JaberNazionalità Iraq Altezza175 cm Calcio RuoloPortiere Termine carriera2011 CarrieraSquadre di club1 1999-2004 Al-Zawraa? (-?)2004-2005 Sanat Naft Abadan? (-?)2005-2008 Al-Zawraa? (-?)2008-2010 Arbil? (-?)2010-2011 Al-Zawraa? (-?) Nazionale 2001-2007 Iraq13 (-?) Palm...