STAT4

STAT4
Ідентифікатори
Символи STAT4, SLEB11, signal transducer and activator of transcription 4
Зовнішні ІД OMIM: 600558 MGI: 103062 HomoloGene: 20679 GeneCards: STAT4
Пов'язані генетичні захворювання
ревматоїдний артрит, синдром Бехчета, гепатоцелюлярна карцинома, primary biliary cholangitis, системна склеродермія, целіакія, системний червоний вовчак[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001243835
NM_003151
NM_011487
NM_001308266
RefSeq (білок)
NP_001230764
NP_003142
NP_001295195
NP_035617
Локус (UCSC) Хр. 2: 191.03 – 191.15 Mb Хр. 1: 52.03 – 52.15 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

STAT4 (англ. Signal transducer and activator of transcription 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 748 амінокислот, а молекулярна маса — 85 941[5].

Послідовність амінокислот
1020304050
MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNE
TMATILLQNLLIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMH
VAVVISNCLREERRILAAANMPVQGPLEKSLQSSSVSERQRNVEHKVAAI
KNSVQMTEQDTKYLEDLQDEFDYRYKTIQTMDQSDKNSAMVNQEVLTLQE
MLNSLDFKRKEALSKMTQIIHETDLLMNTMLIEELQDWKRRQQIACIGGP
LHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQRTHM
LERVTFLIYNLFKNSFVVERQPCMPTHPQRPLVLKTLIQFTVKLRLLIKL
PELNYQVKVKASIDKNVSTLSNRRFVLCGTNVKAMSIEESSNGSLSVEFR
HLQPKEMKSSAGGKGNEGCHMVTEELHSITFETQICLYGLTIDLETSSLP
VVMISNVSQLPNAWASIIWYNVSTNDSQNLVFFNNPPPATLSQLLEVMSW
QFSSYVGRGLNSDQLHMLAEKLTVQSSYSDGHLTWAKFCKEHLPGKSFTF
WTWLEAILDLIKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFS
ESHLGGITFTWVDHSESGEVRFHSVEPYNKGRLSALPFADILRDYKVIMA
ENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIP
ISTIRSDSTEPHSPSDLLPMSPSVYAVLRENLSPTTIETAMKSPYSAE

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Yao B.B., Niu P., Surowy C.S., Faltynek C.R. (1999). Direct interaction of STAT4 with the IL-12 receptor. Arch. Biochem. Biophys. 368: 147—155. PMID 10415122 DOI:10.1006/abbi.1999.1302
  • Naeger L.K., McKinney J., Salvekar A., Hoey T. (1999). Identification of a STAT4 binding site in the interleukin-12 receptor required for signaling. J. Biol. Chem. 274: 1875—1878. PMID 9890938 DOI:10.1074/jbc.274.4.1875

Примітки

  1. Захворювання, генетично пов'язані з STAT4 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:11365 (англ.) . Процитовано 28 серпня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  5. UniProt, Q14765 (англ.) . Архів оригіналу за 20 жовтня 2017. Процитовано 28 серпня 2017.

Див. також


Read other articles:

Tak sama dengan Amyntas, Tetrark Tectosagii. Untuk orang lain dengan nama yang sama, lihat Amintas dari Galatia (disambiguasi). Sebuah koin Galatia yang menggambarkan AmyntasAmyntas (bahasa Yunani Kuno: Ἀμύντας), Tetrark Trokmi adalah seorang Raja Galatia dan beberapa negara terdekat antara 36 dan 25 SM, yang disebutkan oleh Strabo[1] karena sezaman dengan dirinya sendiri. Ia adalah putra dari Brogitarus, raja Galatia, dan Adobogiona, putri dari raja Deiotarus Philoromaeus...

Este artículo se refiere o está relacionado con una producción cinematográfica futura o en desarrollo. La información de este artículo puede cambiar frecuentemente. Por favor, no agregues datos especulativos y recuerda colocar referencias a fuentes fiables para dar más detalles. Avengers: The Kang Dynasty Ficha técnicaProducción Kevin FeigeGuion Michael WaldronBasada en Marvel ComicsProtagonistas Jonathan Majors Ver todos los créditos (IMDb)Datos y cifrasPaís Estados UnidosAño 202...

Regional unit in Attica, GreeceEast Attica Περιφερειακή ενότηταΑνατολικής ΑττικήςRegional unitMunicipalities of East AtticaLocation of East Attica within GreeceCoordinates: 38°0′N 23°57′E / 38.000°N 23.950°E / 38.000; 23.950CountryGreeceRegionAtticaArea • Total1,513 km2 (584 sq mi)Population (2021) • Total516,549 • Density340/km2 (880/sq mi)Time zoneUTC+2 (EET) 

Technique for doubling the perceived frame rate of a video display Interlaced redirects here. For other uses, see Interlace. This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Interlaced video&#...

رون غيلبرت   معلومات شخصية الميلاد 1 يناير 1964 (59 سنة)  لا غراندي  مواطنة الولايات المتحدة  الحياة العملية المهنة منتج ألعاب فيديو،  ومهندس،  ومدون،  ومبرمج،  ومصمم ألعاب فيديو  [لغات أخرى]‏  اللغات الإنجليزية  مجال العمل مصمم ألعاب فيديو ...

Municipio de Clifton Municipio Municipio de CliftonUbicación en el condado de Traverse en Minnesota Ubicación de Minnesota en EE. UU.Coordenadas 45°48′37″N 96°18′22″O / 45.810277777778, -96.306111111111Entidad Municipio • País  Estados Unidos • Estado  Minnesota • Condado TraverseSuperficie   • Total 99.23 km² • Tierra 99.22 km² • Agua (0 %) 0 km²Altitud   • Media 312 m s. n. m.Poblaci

هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (أبريل 2019) سارة جاكوبسون معلومات شخصية الميلاد 25 أغسطس 1971  نوروولك (كونيتيكت)  الوفاة 13 فبراير 2004 (32 سنة)   نيويورك  سبب الوفاة سرطان الرحم  مواطنة الولايات ال

هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (سبتمبر 2021) محمد سليم شوشة معلومات شخصية الميلاد سنة 1985 (العمر 37–38 سنة)  مواطنة مصر  الحياة العملية المدرسة الأم جامعة الفيوم (الشهادة:إجازة جامعية) (–2006)جامعة ا...

VlokkenVlokken sebagai taburan rotiSajianSarapanTempat asalBelandaDaerahSeluruh wilayah dalam negeriDibuat olehDe RuijterSuhu penyajianTaburanBahan utamaCokelat Vlokken (bahasa Belanda untuk serpihan) adalah taburan yang digunakan untuk roti lapis di Belanda.[1] Satu vlok terbuat dari cokelat dan melengkung, ukurannya sekitar 0,5 cm x 2 cm x 0,1 cm. Untuk mempersiapkan vlokken ala Belanda, sepotong roti diolesi dengan mentega atau margarin. Kemudian beberapa sendok vlokken ditaburkan ...

غزو الجزائر جزء من الغزو الفرنسي للجزائر معلومات عامة التاريخ 5 يونيو 1830 البلد إيالة الجزائر الموقع الجزائر العاصمة  36°46′35″N 3°03′31″E / 36.776388888889°N 3.0586111111111°E / 36.776388888889; 3.0586111111111  النتيجة النصر الفرنسي ضم الجزائر من قبل فرنسا انهيار إيالة الجزائر بداية الغز...

This article is an orphan, as no other articles link to it. Please introduce links to this page from related articles; try the Find link tool for suggestions. (March 2017) EMIGMADeveloper(s)Petros Eikon IncorporatedInitial releaseMarch 1994; 29 years ago (1994-03)Stable releaseV9.1 / October 2016; 7 years ago (2016-10) Operating systemWindows 95 and laterLicenseProprietary non-transferableWebsitewww.petroseikon.com/emigma EMIGMA is a geophysics in...

Television series This article may require cleanup to meet Wikipedia's quality standards. The specific problem is: Not following MOS:TV. Please help improve this article if you can. (June 2021) (Learn how and when to remove this template message) JumanjiGenreAction/AdventureDark fantasyBased onJumanjiby Chris Van AllsburgVoices of Bill Fagerbakke Debi Derryberry Ashley Johnson Pamela Adlon Melanie Chartoff Tim Curry Sherman Howard Richard Allen William Sanderson Kevin Schon Theme music compos...

Canadian reality television competition series Not to be confused with Canada's a Drag. For the current season, see Canada's Drag Race (season 4). Canada's Drag RaceAlso known asDrag Race CanadaGenreReality competitionCreated byRuPaulBased onRuPaul's Drag RaceDirected byShelagh O'BrienJudges Brooke Lynn Hytes Jeffrey Bowyer-Chapman Stacey McKenzie Amanda Brugel Brad Goreski Traci Melchor Theme music composerRuPaulOpening themeRuPaul's Drag Race ThemeEnding themeU Wear It WellCountry of origin...

Artikel ini tidak memiliki bagian pembuka yang sesuai dengan standar Wikipedia. Mohon tulis paragraf pembuka yang informatif sehingga pembaca dapat memahami maksud dari Gangguan tidur. Contoh paragraf pembuka Gangguan tidur adalah .... (Pelajari cara dan kapan saatnya untuk menghapus pesan templat ini) Artikel ini memberikan informasi dasar tentang topik kesehatan. Informasi dalam artikel ini hanya boleh digunakan hanya untuk penjelasan ilmiah, bukan untuk diagnosis diri dan tidak dapat mengg...

Public Transport map of Vijayawada Transport in Vijayawada is the network of roads, railways, rapid transit system in the second largest city of Andhra Pradesh. The city of Vijayawada also serves as the central hub of transport and logistics within the state. There are various modes of transportation available in Vijayawada. It includes auto rickshaws, bicycles to mass transit systems such as buses and trains. Roadways Bus Rapid Transit System road in Vijayawada The city has a total road leng...

Artikel ini sebatang kara, artinya tidak ada artikel lain yang memiliki pranala balik ke halaman ini.Bantulah menambah pranala ke artikel ini dari artikel yang berhubungan atau coba peralatan pencari pranala.Tag ini diberikan pada Agustus 2017. Dr. (Hc).Tjetje Hidayat PadmadinataLahirTjetje Hidajat Padmadinata(1935-06-22)22 Juni 1935BandungMeninggal9 November 2022(2022-11-09) (umur 87)Rumah Sakit Hasan Sadikin, BandungKebangsaanIndonesiaPendidikan Bahasa dan Sastra Inggris, PTPG sekarang...

Teide Teide 3D Teide adalah nama sebuah gunung berapi di Pulau Tenerife dan Kepulauan Canaria, Spanyol yang masih sangat aktif hingga saat ini. Mengukur 3.718 meter dan merupakan gunung tertinggi di Spanyol, Samudra Atlantik pulau dan gunung berapi terbesar ketiga di Bumi oleh basisnya (setelah Mauna Loa dan Mauna Kea di Hawaii). Gunung Teide menjadi objek wisata bagi para wisatawan. Kini Teide termasuk ke dalam kawasan Taman Nasional Teide (Parque Nacional del Teide) Situs Warisan Dunia UNES...

Church in King's Lynn, United KingdomOur Lady of the Annunciation Church52°44′54″N 0°24′08″E / 52.7482°N 0.4023°E / 52.7482; 0.4023OS grid referenceTF62231943LocationKing's LynnCountryUnited KingdomDenominationRoman CatholicWebsiteOfficial websiteHistoryStatusActiveFounded10 May 1844DedicationOur Lady of the AnnunciationConsecrated8 May 1845ArchitectureFunctional statusParish churchHeritage designationGrade IIDesignated7 November 2022Architect(s)Augustus Pu...

King in the epic Mahabharata ShantanuShantanu meets a beautiful woman,who turns out to be the goddess Ganga.Personal informationParentsPratipa (father)Sunanda (mother)SiblingsDevapi (brother)Bahlika (brother)SpouseGangaSatyavatiChildrenBhishmaChitrangadaVichitraviryaDynastyKuru-Chandravamsha Shantanu (Sanskrit: शांतनु)[1] is a character in the Mahabharata, described as the a ruler of the Kuru Kingdom with his capital at Hastinapura.[2] He was a descendant of the Bh...

Unclassified language spoken in Chad Laalyəw láàlNative toChadRegionGori, Damtar, Mailao villages in Moyen-Chari prefectureNative speakers750 (2000)[1]Language familylanguage isolateDialects Gori Laabe Language codesISO 639-3gdmGlottologlaal1242ELPLaalLocation within Chad where the Laal language is spokenThis article contains IPA phonetic symbols. Without proper rendering support, you may see question marks, boxes, or other symbols instead of Unicode characters. For an in...