TAF11

TAF11
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TAF11, MGC:15243, TAF2I, TAFII28, PRO2134, TATA-box binding protein associated factor 11
Зовнішні ІД OMIM: 600772 MGI: 1916026 HomoloGene: 55918 GeneCards: TAF11
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001270488
NM_005643
NM_026836
NM_001379368
RefSeq (білок)
NP_001257417
NP_005634
NP_081112
NP_001366297
Локус (UCSC) Хр. 6: 34.88 – 34.89 Mb Хр. 17: 28.12 – 28.13 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TAF11 (англ. TATA-box binding protein associated factor 11) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 211 амінокислот, а молекулярна маса — 23 307[4].

Послідовність амінокислот
1020304050
MDDAHESPSDKGGETGESDETAAVPGDPGATDTDGIPEETDGDADVDLKE
AAAEEGELESQDVSDLTTVEREDSSLLNPAAKKLKIDTKEKKEKKQKVDE
DEIQKMQILVSSFSEEQLNRYEMYRRSAFPKAAIKRLIQSITGTSVSQNV
VIAMSGISKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQI
PNSKHKKIIFF

Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Локалізований у ядрі.

Література

  • Kuzuhara T., Horikoshi M. (1996). Isolation and characterization of a cDNA encoding a human TFIID subunit containing a variety of putative structural motifs including direct repeats. Biol. Pharm. Bull. 19: 122—126. PMID 8820923 DOI:10.1248/bpb.19.122
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:11544 (англ.) . Процитовано 6 вересня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, Q15544 (англ.) . Архів оригіналу за 24 жовтня 2016. Процитовано 6 вересня 2017.

Див. також

Read other articles:

Ця стаття потребує додаткових посилань на джерела для поліпшення її перевірності. Будь ласка, допоможіть удосконалити цю статтю, додавши посилання на надійні (авторитетні) джерела. Зверніться на сторінку обговорення за поясненнями та допоможіть виправити недоліки. Мат...

The SavagesPoster film The SavagesSutradara Tamara Jenkins Produser Ted Hope Anne Carey Erica Westheimer Ditulis oleh Tamara Jenkins PemeranLaura LinneyPhilip Seymour HoffmanPenata musikStephen TraskSinematograferMott HupfelPenyuntingBrian A. KatesPerusahaanproduksiThis Is That ProductionsAd Hominem EnterprisesDistributorSearchlight PicturesTanggal rilis 19 Januari 2007 (2007-01-19) (Festival Film Sundance) 28 November 2007 (2007-11-28) (Amerika Serikat) Durasi114 meni...

3rd episode of the 1st season of Ford Startime The Turn of the ScrewFord Startime episodeAdvertisement for The Turn of the ScrewEpisode no.Season 1Episode 3Directed byJohn FrankenheimerWritten byJames Costigan (teleplay), Henry James (novella)Featured musicDavid AmramOriginal air dateOctober 20, 1959 (1959-10-20)Running time1:21Guest appearance Ingrid Bergman as Governess Episode chronology ← PreviousThe Jazz Singer Next →The Secret World of Kids The Turn of ...

2018 studio album by MorcheebaBlaze AwayStudio album by MorcheebaReleased1 June 2018 (2018-06-01)Length35:15LabelFly AgaricMorcheeba chronology Head Up High(2013) Blaze Away(2018) Blackest Blue(2021) Blaze Away is the ninth studio album by British band Morcheeba. It was released in June 2018 under Fly Agaric Records. It is the first Morcheeba album not to have involvement by Paul Godfrey, who left the band in 2014 after the release of the previous album Head Up High. ...

هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (أبريل 2019) كاترين روبرتسون   معلومات شخصية الميلاد سنة 1966 (العمر 56–57 سنة)  ويلينغتون  مواطنة نيوزيلندا  الحياة العملية المهنة كاتِبة  المواقع الموقع الم...

American production company This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Protozoa Pictures – news · newspapers · books · scholar · JSTOR (November 2017) (Learn how and when to remove this template message) Protozoa PicturesTypePrivateIndustryMotion pictureFounded1997; 26 years ago (1997)...

For the RJD2 album, see Deadringer (album). 1981 studio album by Meat LoafDead RingerStudio album by Meat LoafReleasedSeptember 4, 1981RecordedFebruary–June 1981GenreRockLength42:10LabelCleveland InternationalEpicProducerStephan GalfasJimmy IovineMeat LoafJim SteinmanMeat Loaf chronology Bat Out of Hell(1977) Dead Ringer(1981) Midnight at the Lost and Found(1983) Singles from Dead Ringer I'm Gonna Love Her for Both of UsReleased: September 1981[1] Dead Ringer for LoveRelease...

Intrigue in the Bakumatsu - IrohanihohetoBerkas:Irohanihohetto.jpgBakumatsu Kikansetsu Irohanihoheto幕末機関説 いろはにほへと(Bakumatsu Kikansetsu Irohanihoheto)GenreDrama, Sejarah, Misteri, Supernatural, Percintaan Seri animeSutradaraRyōsuke TakahashiStudioSunriseSaluranasliGyaO Internet StreamingTayang 6 Oktober 2006 – 6 April 2007Episode26 (Daftar episode)  Portal anime dan manga Intrigue in the Bakumatsu - Irohanihoheto (Jepang: 幕末機関説 いろはにほへ...

Canadian medical drama TV series RemedyTV series posterGenreMedical DramaFamily dramaCreated byGreg SpottiswoodStarringEnrico ColantoniSara CanningDillon CaseyGenelle WilliamsSarah AllenMatt WardPatrick McKennaMartha BurnsNiall MatterCountry of originCanadaNo. of seasons2No. of episodes20ProductionExecutive producersGreg SpottiswoodBernie ZukermanKelly MakinAdam BarkenProducerJan Peter MeyboomProduction companyIndian Grove ProductionsOriginal releaseNetworkGlobal (Canada) Ovation (American TV...

Neighborhood of the Bronx in New York CityMott HavenNeighborhood of the BronxEast 139th Street, between Willis and Brook Avenues, facing eastNickname: The Boogie Down BronxLocation in New York CityCoordinates: 40°48′36″N 73°55′34″W / 40.81°N 73.926°W / 40.81; -73.926Country United StatesState New YorkCity New York CityBorough The BronxCommunity DistrictBronx 1[1]Founded1849Named forJordan Lawrence MottArea[2] • Tot...

Mughal tombs are a set of tombs built by various ruling in Mughal Emperors. All of them have marked influence from Iranian Timurid forms. The Mughal dynasty was established after the victory of Babur at Panipat in 1526. During his five-year reign, Babur took considerable interest in erecting buildings, though few have survived. His grandson Akbar built widely, and the style developed vigorously during his reign. Among his accomplishments were Agra Fort, the fort-city of Fatehpur Sikri, and th...

Der Averdunkshof in Neukirchen-Vluyn (September 2011) Der Averdunkshof ist eine alte, denkmalgeschützte Bauernhofanlage im äußersten Nordwesten des Stadtteils Neukirchen in Neukirchen-Vluyn, Kreis Wesel, Nordrhein-Westfalen. Sie wurde 1290 erstmals erwähnt. Mit dem Bezug der Familie um Heinrich Averdunk 1848 wurde sie der Stammhof der Familie.[1] In der Karte des Kataster-Geometers M. Buyx, Neukirchen-Vluyn vor 1800, wird der Hof ebenfalls unter der Bezeichnung Overdunk mit d...

Region in northern Albania; historic Albanian tribe Part of a series onAlbanian tribes Tribes and regions Malësia e Madhe Hoti Gruda Kelmendi Shkreli Rrjolli Kastrati Trieshi Koja Marsheni Tuzi Gruemiri Reçi Lohja Lepuroshi Boga Dukagjin highlands Bobi Shala Shoshi Shllaku Dushmani Toplana Mavriqi Mazreku Prekali Pult Kiri Plani Xhani Suma Highlands of Gjakova Krasniqi Nikaj Mërturi Gashi Bytyqi Morina Puka-Mirdita Berisha Mirdita Puka Malziu Thaçi Qerreti Kabashi Selita Dukagjini Upper D...

Daftar bahasa di Kepulauan Riau merupakan daftar bahasa-bahasa yang berasal, dan tersebar di provinsi Kepulauan Riau, Indonesia. Nama bahasa Suku bangsa Bahasa Hokkien Tionghoa Bahasa Melayu Melayu Bahasa Melayu Baba Peranakan Bahasa Melayu Kepulauan Riau Melayu (masyarakat Kepulauan Riau) Bahasa Melayu Pulau Tujuh Melayu (masyarakat Pulau Tujuh) Bahasa Melayu Riau Melayu Riau Bahasa Tamil India Bahasa Tiochiu Tionghoa Pranala luar Kantor Bahasa Provinsi Kepulauan Riau. [pranala nona...

Location of Fayette County in West Virginia This is a list of the National Register of Historic Places listings in Fayette County, West Virginia. This is intended to be a complete list of the properties and districts on the National Register of Historic Places in Fayette County, West Virginia, United States. The locations of National Register properties and districts for which the latitude and longitude coordinates are included below, may be seen in an online map.[1] There are 28 prop...

American professional basketball team of the NBA G League Maine CelticsConferenceEasternLeagueNBA G LeagueFounded2009HistoryMaine Red Claws2009–2021Maine Celtics2021–presentArenaPortland Exposition BuildingLocationPortland, MaineTeam colorsGreen, white, black, brown[1][2]       Main sponsorVistaprintPresidentDajuan EubanksGeneral managerJarell ChristianHead coachBlaine MuellerOwnershipBoston CelticsAffiliation(s)Boston CelticsChampionships0Conference ti...

This article uses bare URLs, which are uninformative and vulnerable to link rot. Please consider converting them to full citations to ensure the article remains verifiable and maintains a consistent citation style. Several templates and tools are available to assist in formatting, such as reFill (documentation) and Citation bot (documentation). (August 2022) (Learn how and when to remove this template message) This list contains entries that may be out of scope and need to be evaluated for re...

2014 Indian filmRomeoDirected byGopiganesh PattabhiWritten byPuri JagannadhProduced byDorai SwamyStarringSairam ShankarAdonikaCinematographyP. G. VindaEdited byNaveen NooliMusic bySunil KashyapRelease date 10 October 2014 (2014-10-10) CountryIndiaLanguageTelugu Romeo (Telugu: రోమియో) is a 2014 Telugu drama film starring Sairam Shankar and Adonika in the lead, directed by Gopiganesh Pattabhi. Valluripalli Ramesh produced this movie under the Maharshi Cinema Banner an...

Hudya GroupFormationAugust 8, 2016; 7 years ago (2016-08-08)TypePrivateHeadquartersOslo, NorwayArea served Norway, Sweden and DenmarkServicesUtility services, Telecom and Insurance servicesKey peopleBørge Leknes (CEO), Morten Kvam (CCO), Pål Lauvrak (Head of Concept Development)Websitehudyagroup.com/en Hudya is a Nordic fintech company. The company has developed a digital platform simplifying the purchase of traditional consumer services such as electricity, telecom, insur...

Japanese volleyball player This biography of a living person needs additional citations for verification. Please help by adding reliable sources. Contentious material about living persons that is unsourced or poorly sourced must be removed immediately from the article and its talk page, especially if potentially libelous.Find sources: Akiko Ino – news · newspapers · books · scholar · JSTOR (October 2008) (Learn how and when to remove this template mess...