GTF2B

GTF2B
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GTF2B, TF2B, TFIIB, general transcription factor IIB
Зовнішні ІД OMIM: 189963 MGI: 2385191 HomoloGene: 1158 GeneCards: GTF2B
Пов'язані генетичні захворювання
ожиріння[1]
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001514
NM_145546
RefSeq (білок)
NP_001505
NP_663521
Локус (UCSC) Хр. 1: 88.85 – 88.89 Mb Хр. 3: 142.47 – 142.49 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Див. також: 2B (значення)

GTF2B (англ. General transcription factor IIB) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 316 амінокислот, а молекулярна маса — 34 833[5].

Послідовність амінокислот
1020304050
MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGS
EWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSK
YQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKS
LKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILK
ALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSP
ISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLF
PTDFKFDTPVDKLPQL

Задіяний у таких біологічних процесах як взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у ядрі.

Література

  • Ha I., Lane W.S., Reinberg D. (1991). Cloning of a human gene encoding the general transcription initiation factor IIB. Nature. 352: 689—695. PMID 1876184 DOI:10.1038/352689a0
  • Malik S., Hisatake K., Sumimoto H., Horikoshi M., Roeder R.G. (1991). Sequence of general transcription factor TFIIB and relationships to other initiation factors. Proc. Natl. Acad. Sci. U.S.A. 88: 9553—9557. PMID 1946368 DOI:10.1073/pnas.88.21.9553
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Umehara T., Kida S., Yamamoto T., Horikoshi M. (1995). Isolation and characterization of a cDNA encoding a new type of human transcription elongation factor S-II. Gene. 167: 297—302. PMID 8566795 DOI:10.1016/0378-1119(95)00634-6
  • Yuan C.X., Gurley W.B. (2000). Potential targets for HSF1 within the preinitiation complex. Cell Stress Chaperones. 5: 229—242. PMID 11005381 DOI:10.1379/1466-1268(2000)005<0229:PTFHWT>2.0.CO;2
  • Chen H.T., Legault P., Glushka J., Omichinski J.G., Scott R.A. (2000). Structure of a (Cys3His) zinc ribbon, a ubiquitous motif in archaeal and eucaryal transcription. Protein Sci. 9: 1743—1752. PMID 11045620 DOI:10.1110/ps.9.9.1743

Примітки

  1. Захворювання, генетично пов'язані з GTF2B переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:4648 (англ.) . Процитовано 25 серпня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  5. UniProt, Q00403 (англ.) . Архів оригіналу за 24 вересня 2017. Процитовано 25 серпня 2017.

Див. також

Read other articles:

Cliff RobertsonCliff Robertson (1981)LahirClifford Parker Robertson III(1923-09-09)9 September 1923La Jolla, California, Amerika SerikatMeninggal10 September 2011(2011-09-10) (umur 88)Stony Brook, New York, Amerika SerikatTahun aktif1943 - 2007Suami/istriCynthia Stone (1957-1959) Dina Merrill (1966-1986) Clifford Parker Robertson III (9 September 1923 – 10 September 2011) merupakan seorang aktor berkebangsaan Amerika Serikat yang memenangkan Academy Award. Dia dilahi...

Pantai Kuri Caddi Lokasi di Indonesia Informasi Lokasi Dusun Kuri Caddi,[1] Desa Nisombalia, Kecamatan Marusu, Kabupaten Maros, Sulawesi Selatan Negara  Indonesia Koordinat 5°01′47″S 119°27′56″E / 5.0298014°S 119.4654594°E / -5.0298014; 119.4654594Koordinat: 5°01′47″S 119°27′56″E / 5.0298014°S 119.4654594°E / -5.0298014; 119.4654594 Pengelola Kelompok Sadar Wisata (Pokdarwis) Desa NisombaliaDinas Kebudayaan d...

An Giang FCDatos generalesNombre Hùng Vương An Giang Football ClubApodo(s) Đội bóng miền Tây(Equipo de Fútbol Occidental)Fundación 1976Presidente Dương Ngọc MinhEntrenador Nhan Thiện NhânInstalacionesEstadio An Giang StadiumCapacidad 10,000Ubicación Long Xuyên, An Giang, Vietnam Titular Alternativo Última temporadaLiga V-League 2(2013) 3º [editar datos en Wikidata] El An Giang FC es un equipo de fútbol de Vietnam que juega en la V-League, la liga de fútbol m...

روجر غريفين   معلومات شخصية الميلاد 31 يناير 1948 (75 سنة)  مواطنة المملكة المتحدة  عضو في الجمعية التاريخية الملكية  [لغات أخرى]‏  الحياة العملية المدرسة الأم جامعة أكسفورد  شهادة جامعية دكتوراه في الفلسفة  المهنة مؤرخ  اللغات الإنجليزية  مجال العمل...

ملفان  يوحنا ذهبي الفم (باليونانية: Ἰωάννης ὁ Χρυσόστομος)‏  صورة له في كنيسة آية صوفيا في إسطنبول من القرن الرابع الميلادي معلومات شخصية الميلاد 349أنطاكية الوفاة 15 سبتمبر 407 مواطنة الإمبراطورية البيزنطية  مناصب الحياة العملية تعلم لدى ليبانيوس  المهنة عالم عقيد

Queen's Own YeomanryCap badgeActive1971–presentAllegiance United KingdomBranch British ArmyTypeYeomanryRoleLight Cavalry RegimentSizeRegiment368 personnel[1]Part ofRoyal Armoured CorpsGarrison/HQRegimental Headquarters - Fenham Barracks, Newcastle upon TyneA Squadron - YorkB squadron - WiganC Squadron - ChesterD Squadron - NewcastleColoursPrussian Blue & Cavalry GoldMarchD'ye Ken John PeelCommandersCommanding OfficerLt Col Neil PotterRoyal Honorary ColonelThe Duch...

United States historic placeSchick's Express and Transfer Co.Formerly listed on the U.S. National Register of Historic Places Schick's Express and Transfer Co. buildingShow map of IowaShow map of the United StatesLocation118-120 W. River Dr.Davenport, IowaCoordinates41°31′11″N 90°34′29″W / 41.51972°N 90.57472°W / 41.51972; -90.57472Built1905ArchitectClausen & ClausenArchitectural styleEarly CommercialMPSDavenport MRANRHP reference No...

Indian communist (1928–1970) This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Arikkad Varghese – news · newspapers · books · scholar · JSTOR (April 2010) (Learn how and when to remove this template message) Naxal Varghese1st Kerala State Secretary of CPIMLIn office1969–1970 Personal detailsBorn(1938-06-14...

Roxette discographyRoxette on stage in Weert 2011Studio albums10Live albums1Compilation albums13Video albums11Music videos52Singles56Promotional singles20Remix albums1Box sets3 The discography of Swedish pop duo Roxette consists of ten studio albums (including six Swedish number ones), one live album, thirteen compilation albums, one remix album, eleven video albums, three box sets, fifty-six singles (including three Swedish and four US number ones) and twenty promotional singles, as well as ...

Kementerian Pertahanan Federasi RusiaМинистерство обороны Российской ФедерацииMinisterstvo oborony Rossiyskoy FederatsiiLambang Kementerian PertahananBendera Kementerian PertahananKantor Kementerian Pertahanan di MoskwaInformasi lembagaDibentuk1717 (sebagai Kolegium Perang)Nomenklatur lembaga sebelumnyaKolegium Perang (1717–1802) Kementerian Perang Kekaisaran Rusia (1802–1917) Komisariat Pertahanan Rakyat Uni Soviet (1934–1946) Kementerian Pertahana...

Hrvatski IdolPembuatSimon FullerPemeranDorde NovkovicMiroslav ŠkoroNikša BratošGoran KaranNegara asalKroasiaRilisJaringan asliNova TVRilis asli2004 –2005 Finalis(beserta tanggal tereliminasi) Musim Pertama (2003-04) Žanamari LalićJuara Pamela Ramljak5 Juni Neda Parmać]29 Mei Linda Švarc22 Mei Alan Šćuric15 Mei Ivana Marić8 Mei Denis Mladenović1 Mei Karmen Matković24 April Musim Kedua(2004-05) Patrick JurdićJuara Lidija Bačić26 Februari Marina Kristić19 Februari Teo Niko...

Swiss-born prelate The Most ReverendJohn Martin HenniArchbishop of MilwaukeeSeeMilwaukeeInstalledNovember 28, 1843Term endedSeptember 7, 1881PredecessornoneSuccessorMichael HeissOrdersOrdinationFebruary 2, 1829ConsecrationMarch 19, 1844Personal detailsBorn(1805-06-15)June 15, 1805Misanenga, Obersaxen, Graubünden, SwitzerlandDiedSeptember 7, 1881(1881-09-07) (aged 76)Milwaukee, Wisconsin, United StatesDenominationRoman Catholic ChurchSignature John Martin Henni (June 15, 1805 – Septemb...

Arab Muslim theologian, writer and scholar (767–820) Imam Shafi redirects here. For the village in Iran, see Emam Safi. For the Egyptian surname with the same Arabic spelling, see El-Shafei. al-Shafi'iاَلشَّافِعِيُّTitleShaykh al-IslāmPersonalBorn767 CE 150 AH Gaza[citation needed], Abbasid CaliphateDied19 January 820 CE (aged 54) 204 AH al-Fustat, Abbasid CaliphateReligionIslamEraIslamic Golden AgeDenominationSunniJurisprudenceMujtahidMain interest(s)Fiqh, HadithNota...

Peta Dunia berbudaya Arab Pan-Arabisme adalah gerakan untuk penyatuan bangsa-bangsa dan negara di dunia Arab yang membentang dari Samudra Atlantik sampai ke Laut Arab. Hal ini berhubung erat dengan budaya nasionalisme dari bangsa Arab yang menegaskan bahwa bangsa Arab merupakan satu kesatuan dalam sebuah bangsa. Ideologi Pan-Arabisme yang sering membawa budaya serta tradisi Arab dan cenderung sekuler dan sosialis, sangat menentang kolonialisme, serta menjaga budaya dan tradisi Arab dari domin...

Galiche RockLocation of Robert Island in the South Shetland IslandsGaliche RockLocation of Galiche RockShow map of AntarcticaGaliche RockGaliche Rock (Antarctic Peninsula)Show map of Antarctic PeninsulaGeographyLocationAntarcticaCoordinates62°23′43″S 59°20′53″W / 62.39528°S 59.34806°W / -62.39528; -59.34806ArchipelagoSouth Shetland IslandsAdministrationAdministered under the Antarctic Treaty SystemDemographicsPopulationUninhabited Galiche Rock (Bulgarian: ...

Traditional limestone roofing material of central England The Collyweston Slater pub in Collyweston with a Collyweston slate roof Collyweston stone slate is a traditional roofing material found in central England.[1] Collyweston quarry at Duddington Collyweston roofs on the Round Church, Cambridge It is not a proper slate but a limestone found in narrow beds. It is considerably heavier than true slate. The slates are quarried near the village of Collyweston in Northamptonshire, near S...

American singer and actress (born 1984) Ashlee SimpsonSimpson in 2012Born (1984-10-03) October 3, 1984 (age 39)Waco, Texas, U.S.Other namesAshlee Simpson-WentzAshlee Simpson RossOccupationsSingersongwriteractresstelevision personalityYears active1999–presentSpouses Pete Wentz ​ ​(m. 2008; div. 2011)​ Evan Ross ​ ​(m. 2014)​ Children3RelativesJessica Simpson (sister)Musical careerGenres Pop rock...

New Zealand sociologist For those of a similar name, see Alyson Jones and Allison Jones (disambiguation). Alison JonesMNZMJones in 2019Alma materUniversity of AucklandAwardsDame Joan Metge, 2014Scientific careerThesis At school I've got a chance...: social reproduction in a New Zealand secondary school (1986) Barbara Alison Jones MNZM is a New Zealand academic who works in the field of sociology of education.[1] She is the great-great-great granddaughter of Andrew Buchanan, ...

Questa voce o sezione sull'argomento musicisti britannici non cita le fonti necessarie o quelle presenti sono insufficienti. Puoi migliorare questa voce aggiungendo citazioni da fonti attendibili secondo le linee guida sull'uso delle fonti. Segui i suggerimenti del progetto di riferimento. Jimmy Bain Nazionalità Regno Unito GenereHeavy metalHard rock Periodo di attività musicale1974 – 2016 GruppiRainbow, Dio, WWIII, 3 Legged Dogg, Last in Line Album pubblicati...

Questa voce sull'argomento stagioni delle società calcistiche italiane è solo un abbozzo. Contribuisci a migliorarla secondo le convenzioni di Wikipedia. Segui i suggerimenti del progetto di riferimento. Voce principale: Unione Sportiva Ancona 1905. Unione Sportiva AnconitanaStagione 1964-1965Sport calcio Squadra Anconitana Allenatore Giorgio Arzeni Presidente Albertino Castellucci Serie C9º posto nel girone B. Maggiori presenzeCampionato: Gambi (32) Miglior marcatoreCampionato: ...