ZNF593

ZNF593
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ZNF593, ZT86, zinc finger protein 593
Зовнішні ІД OMIM: 616698 MGI: 1915290 HomoloGene: 41070 GeneCards: ZNF593
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_015871
NM_024215
RefSeq (білок)
NP_056955
NP_077177
Локус (UCSC) Хр. 1: 26.17 – 26.17 Mb Хр. 4: 133.97 – 133.97 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZNF593 (англ. Zinc finger protein 593) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 134 амінокислот, а молекулярна маса — 15 199[4].

Послідовність амінокислот
1020304050
MGRSRRTGAHRAHSLARQMKAKRRRPDLDEIHRELRPQGSARPQPDPNAE
FDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQE
EAERAAGMGSYVPPRRLAVPTEVSTEVPEMDTST

Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Terunuma A., Shiba K., Noda T. (1997). A novel genetic system to isolate a dominant negative effector on DNA-binding activity of Oct-2. Nucleic Acids Res. 25: 1984—1990. PMID 9115366 DOI:10.1093/nar/25.10.1984
  • Hayes P.L., Lytle B.L., Volkman B.F., Peterson F.C. (2008). The solution structure of ZNF593 from Homo sapiens reveals a zinc finger in a predominantly unstructured protein. Protein Sci. 17: 571—576. PMID 18287285 DOI:10.1110/ps.073290408

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:30943 (англ.) . Процитовано 28 серпня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, O00488 (англ.) . Архів оригіналу за 7 лютого 2017. Процитовано 28 серпня 2017.

Див. також

Read other articles:

Der Titel dieses Artikels ist mehrdeutig. Zum gleichnamigen Wirtschaftsunternehmen siehe Rübezahl Schokoladen, für den als Rübezahl bekannten Weinbauern siehe Johann Trinkl. Vergrößerung des Dämons nach Helwig Modernes Rübezahl-Standbild im Riesengebirge Rübezahl (früher auch: Rübenzahl,[1] tschechisch Krakonoš, polnisch Liczyrzepa) ist der Berggeist (Schrat) des Riesengebirges. Um ihn ranken sich zahlreiche Sagen und Märchen. Inhaltsverzeichnis 1 Name 2 Sage 3 Älteste Be...

Eroski Création 1969 Siège social Elorrio Direction Président : Constant Da Costa, DG : Agustin Markaide Actionnaires 63,5 % Mondragón Corporación Cooperativa, 36,5 % travailleurs-associés (2007)[1] Activité Grande Distribution Société mère Groupe Mondragon Filiales Altis Effectif 50 580 (2007)[1] Site web (es) www.eroski.es Chiffre d'affaires 7,6 milliards d'euros (2000)[1] Résultat net 205,48 millions d'euros (2007) [1] modifier - modifier le code - voir Wikid...

British physicist Kurt MendelssohnBorn(1906-01-07)7 January 1906Berlin-Schoeneberg, German EmpireDied18 September 1980(1980-09-18) (aged 74)Oxford, UKCitizenshipBritishAlma materUniversity of BerlinAwardsFellow of the Royal Society (1951)Hughes Medal (1967)Simon Memorial Prize (1968)Scientific careerFieldsPhysicistInstitutionsUniversity of OxfordDoctoral advisorFranz Eugen SimonOther academic advisorsMax PlanckWalther NernstErwin SchrödingerAlbert EinsteinDoctoral studentsHaro...

The EssentialsCompilación de Twisted SisterPublicación 17 de septiembre de 2002Género(s) Heavy metal Hard rockDuración 46:36Discográfica Warner Music GroupCalificaciones profesionales Allmusic enlace Artistdirect enlace Cronología de Twisted Sister Club Daze Volume 2: Live In The Bars (2001) The Essentials Live At Wacken: The Reunion (2005) [editar datos en Wikidata] The Essentials es un álbum recopilatorio de la banda Twisted Sister lanzado en el año 2002 bajo la discográf...

بحرية جيش التحرير الشعبيمعلومات عامةجزء من جيش التحرير الشعبي الصينيStructure of the People's Liberation Army Navy (en) البداية 23 أبريل 1949 الولاء الحزب الشيوعي الصيني الصراعات الحرب الأهلية الصينية البلد الصين مشغل العنصر People's Liberation Army Navy fleet (en) لديه جزء أو أجزاء People's Liberation Army Naval Air Force (en) People's Li...

Malle Parochie van Denemarken Situering Bisdom Bisdom Viborg Gemeente Vesthimmerlands Coördinaten 56°55'0,001NB, 9°14'12,001OL Algemeen Inwoners (2004) 209 Leden Volkskerk (2004) 191 Overig Kerken Malle Kirke Proosdij Vesthimmerlands Provsti Pastoraat Ranum-Malle Foto's Portaal    Denemarken Malle is een parochie van de Deense Volkskerk in de Deense gemeente Vesthimmerlands. De parochie maakt deel uit van het bisdom Viborg en telt 191 kerkleden op een bevolking van 209 (2004). To...

Van Dedem is een Nederlandse adellijke familie met veel bestuurders. Leden van de familie dragen de titel baron of barones, die overgaat op elke nakomeling. Geschiedenis De stamreeks begint met Arnoldus van Dedem, knape, burgman te Nienborg en Bentheim, die tussen 1297 en 1335 vermeld wordt. Sinds het einde van de zestiende eeuw zijn leden ervan in Nederland gevestigd en hadden zitting in de besturen van Zwolle en Harderwijk. Bij Keizerlijk decreet van 13 maart 1811 van keizer Napoleon I werd...

Cette page donne les sondages sur les élections législatives portugaises du 30 janvier 2022. Les précédentes élections législatives avaient été remportées par le PS avec 36,34 % des voix. Sondages Les résultats listés tiennent compte des votes blancs et nuls, listés dans la colonne autres. Les votes blancs et nuls sont aussi inclus dans le pourcentage total lors des élections législatives. Pour des raisons techniques, il est temporairement impossible d'afficher le graphique...

State highway in Georgia State Route 94Georgia State Route 94 highlighted in redRoute informationMaintained by GDOTLength65.2 mi[1][2] (104.9 km)Western sectionLength52.3 mi[1] (84.2 km)West end US 41 / SR 7 / SR 31 southeast of ValdostaMajor intersections US 129 / SR 11 in Statenville US 441 / SR 89 from Fargo to southeast of Fargo East end SR 2 southeast of FargoEaster...

هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (نوفمبر 2019) سيث ليبسكي   معلومات شخصية الميلاد سنة 1946 (العمر 76–77 سنة)  مواطنة الولايات المتحدة  الحياة العملية المدرسة الأم جامعة هارفارد  المهنة صحفي،  ...

De Witte Singel vanaf de Koepoortsbrug. In de verte de koepels van de Oude Sterrewacht. Rechts de Boisotkade. (Foto: 2003) De Witte Singel is een singel en straat in de Nederlandse stad Leiden. De singel ligt aan de west- en zuidrand van de in de 17e eeuw gereed gekomen singelstructuur die de binnenstad van Leiden omsluit en loopt van het Galgewater (Oude Rijn) tot de Zoeterwoudsesingel. De straat ligt aan de buitenzijde van de singel, de binnen- of centrumzijde kent behalve de Boisotkade gee...

Tunku Laksamana of Johor Tunku Abdul JalilTunku Laksamana of JohorBorn(1990-07-05)5 July 1990Istana Besar, Johor Bahru, JohorDied5 December 2015(2015-12-05) (aged 25)Sultanah Aminah Hospital, Johor Bahru, JohorBurial6 December 2015Mahmoodiah Royal Mausoleum, Johor Bahru, JohorNamesTunku Abdul Jalil Iskandar Ibni Tunku Ibrahim IsmailHouseTemenggongFatherSultan Ibrahim IsmailMotherRaja Zarith SofiahReligionSunni IslamOccupationZookeeper,[1] police officerOther namesLilPolice c...

Exceptionally precocious child Wunderkind redirects here. For other uses, see Wunderkind (disambiguation). Wonder child redirects here. For the song by Christian Walz, see Wonderchild. Boy genius redirects here. For other uses, see Boy genius (disambiguation). Wolfgang Amadeus Mozart, a well-known child prodigy, started composing at the age of five. A child prodigy is a person under the age of ten who produces meaningful work in some domain at the level of an adult expert.[1][2 ...

European club roller hockey competition WSE CupSportRoller hockeyFounded1980; 43 years ago (1980) (rebranded in 2022)Organising bodyWorld Skate Europe - Rink HockeyNo. of teams28 (since 2022–23)Most recentchampion(s) CP Voltregà (2nd title)Most titles HC Liceo Hockey Novara OC Barcelos CE Lleida(3 titles each)RelatedcompetitionsWSE Champions League(1st tier)WSE Continental CupOfficial websiteWSE Cup The WSE Cup is an annual European club roller hockey competition org...

2002 video gameDual HeartsNorth American cover artDeveloper(s)Matrix SoftwarePublisher(s)JP: Sony Computer EntertainmentNA: AtlusDirector(s)Keizo KatoDesigner(s)Hideaki Kikukawa Keizo KatoProgrammer(s)Naomasa Ariki Yuichi Ono Munehiro TaniComposer(s)Tetsuo Ishikawa Masala NishidPlatform(s)PlayStation 2, PlayStation NetworkReleasePlayStation 2JP: February 14, 2002NA: September 23, 2002PlayStation NetworkJP: January 21, 2015Genre(s)Action role-playingMode(s)Single-player Dual Hearts[a] ...

This article does not cite any sources. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Aural Vampire discography – news · newspapers · books · scholar · JSTOR (August 2020) (Learn how and when to remove this template message) Aural Vampire discographyAural Vampire at Mang'Azur 2013Studio albums3Music videos3EPs3Singles2 This is the discography of Japanese darkwave...

Burung-madu Belukar Status konservasi Risiko Rendah Klasifikasi ilmiah Kerajaan: Animalia Filum: Chordata Kelas: Aves Ordo: Passeriformes Famili: Nectariniidae Genus: Anthreptes Spesies: A. singalensis Nama binomial Anthreptes singalensisGmelin, 1788 Burung-madu Belukar adalah spesies burung yang mempunyai paruh, berdarah panas, dan membiak dengan cara bertelur. Pengidentifikasi takson Wikidata: Q27075705 Wikispecies: Chalcoparia singalensis Avibase: 67A740A4B19F444D BirdLife: 22717626 e...

Painting by Giovanni Bellini Holy AllegoryArtistGiovanni BelliniYearc. 1490–1500Mediumoil on canvasDimensions73 cm × 119 cm (29 in × 47 in)LocationGalleria degli Uffizi, Florence The Holy Allegory is a painting by the Italian Renaissance master Giovanni Bellini, dating from c. 1490 to 1500. It is in the Uffizi gallery in Florence, Italy. History There is no documentation about the commission and the original location of the work, which is known to...

Silverstein Properties, Inc. Logo Rechtsform Incorporated Gründung 1957 Sitz New York City, New York, Vereinigte Staaten Vereinigte Staaten Leitung Larry Silverstein Branche Immobiliengesellschaft Website www.silversteinproperties.com Silverstein Properties, Inc. ist eine US-amerikanische Immobiliengesellschaft, die ihren Sitz in New York City hat. Das Unternehmen wurde im Jahr 1957 von Harry Silverstein gegründet. Heute ist dessen Sohn Larry Silverstein Vorsitzender von Silverstein Pr...

Romanian politician Vlad GheorgheMember of the European ParliamentIncumbentAssumed office 10 November 2020 Personal detailsBornVlad Gheorghe (1985-02-22) 22 February 1985 (age 38)Bucharest, RomaniaOther politicalaffiliationsRenew Europe (2019–) Vlad Gheorghe (born on 22 February 1985), is a Romanian politician who is currently a member of the European Parliament.[1] Biography Vlad Gheorghe was born in Bucharest on 22 February 1985. Gheorghe is a lawyer specializing in admin...