JADE1

JADE1
Ідентифікатори
Символи JADE1, PHF17, jade family PHD finger 1
Зовнішні ІД OMIM: 610514 MGI: 1925835 HomoloGene: 18162 GeneCards: JADE1
Шаблон експресії




Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001130184
NM_001130185
NM_001130186
NM_172303
RefSeq (білок)
NP_001123656
NP_001123657
NP_001123658
NP_758507
Локус (UCSC) Хр. 4: 128.81 – 128.88 Mb Хр. 3: 41.51 – 41.57 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

JADE1 (англ. Jade family PHD finger 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 842 амінокислот, а молекулярна маса — 95 533[4].

Послідовність амінокислот
1020304050
MKRGRLPSSSEDSDDNGSLSTTWSQNSRSQHRRSSCSRHEDRKPSEVFRT
DLITAMKLHDSYQLNPDEYYVLADPWRQEWEKGVQVPVSPGTIPQPVARV
VSEEKSLMFIRPKKYIVSSGSEPPELGYVDIRTLADSVCRYDLNDMDAAW
LELTNEEFKEMGMPELDEYTMERVLEEFEQRCYDNMNHAIETEEGLGIEY
DEDVVCDVCQSPDGEDGNEMVFCDKCNICVHQACYGILKVPEGSWLCRTC
ALGVQPKCLLCPKKGGAMKPTRSGTKWVHVSCALWIPEVSIGSPEKMEPI
TKVSHIPSSRWALVCSLCNEKFGASIQCSVKNCRTAFHVTCAFDRGLEMK
TILAENDEVKFKSYCPKHSSHRKPEESLGKGAAQENGAPECSPRNPLEPF
ASLEQNREEAHRVSVRKQKLQQLEDEFYTFVNLLDVARALRLPEEVVDFL
YQYWKLKRKVNFNKPLITPKKDEEDNLAKREQDVLFRRLQLFTHLRQDLE
RVRNLTYMVTRREKIKRSVCKVQEQIFNLYTKLLEQERVSGVPSSCSSSS
LENMLLFNSPSVGPDAPKIEDLKWHSAFFRKQMGTSLVHSLKKPHKRDPL
QNSPGSEGKTLLKQPDLCGRREGMVVPESFLGLEKTFAEARLISAQQKNG
VVMPDHGKRRDNRFHCDLIKGDLKDKSFKQSHKPLRSTDVSQRHLDNTRA
ATSPGVGQSAPGTRKEIVPKCNGSLIKVNYNQTAVKVPTTPASPVKNWGG
FRIPKKGERQQQGEAHDGACHQHSDYPYLGLGRVPAKERAKSKLKSDNEN
DGYVPDVEMSDSESEASEKKCIHTSSTISRRTDIIRRSILAS

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як апоптоз, транскрипція, регуляція транскрипції, поліморфізм, ацетиляція, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у цитоплазмі, цитоскелеті, ядрі, клітинних відростках.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O. (2001). Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 8: 85—95. PMID 11347906 DOI:10.1093/dnares/8.2.85
  • Tzouanacou E., Tweedie S., Wilson V. (2003). Identification of Jade1, a gene encoding a PHD zinc finger protein, in a gene trap mutagenesis screen for genes involved in anteroposterior axis development. Mol. Cell. Biol. 23: 8553—8562. PMID 14612400 DOI:10.1128/MCB.23.23.8553-8562.2003
  • Panchenko M.V., Zhou M.I., Cohen H.T. (2004). von Hippel-Lindau partner Jade-1 is a transcriptional co-activator associated with histone acetyltransferase activity. J. Biol. Chem. 279: 56032—56041. PMID 15502158 DOI:10.1074/jbc.M410487200

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:30027 (англ.) . Архів оригіналу за 28 травня 2017. Процитовано 30 серпня 2017. [Архівовано 2017-05-28 у Wayback Machine.]
  4. UniProt, Q6IE81 (англ.) . Архів оригіналу за 20 червня 2017. Процитовано 30 серпня 2017.

Див. також

Read other articles:

Artikel ini sebatang kara, artinya tidak ada artikel lain yang memiliki pranala balik ke halaman ini.Bantulah menambah pranala ke artikel ini dari artikel yang berhubungan atau coba peralatan pencari pranala.Tag ini diberikan pada Desember 2022. Pembebasan Korea David Kwang-sun Suh adalah seorang teolog Korea.[1] Dia melihat adanya kerjasama antara Kristen Korea dengan Minjung Korea.[1] Keduanya sama-sama termasuk dalam Gerakan Kemerdekan Satu Maret 1919 untuk menentang penjaj...

 

 

Croatian football manager Ante Čačić Čačić as manager of Dinamo Zagreb in 2011Personal informationDate of birth (1953-09-29) 29 September 1953 (age 70)Place of birth Zagreb, FPR YugoslaviaManagerial careerYears Team1986–1987 Prigorje Markuševec1988–1989 TPK1989–1992 Zadar1992–1993 Dubrava1993–1995 Inter Zaprešić1994–1998 Croatia U21 (assistant)1995–1996 Osijek1996–1997 Zadar1998 Slaven Belupo1998–2000 Croatia Sesvete2002–2003 Inter Zaprešić2005–2006 Libya...

 

 

American country music duo Brooks & DunnRonnie Dunn (left) and Kix Brooks (right) in March 2017Background informationOriginNashville, Tennessee, U.S.GenresNeotraditional country[1]Years active1990–2010, 2015–presentLabelsArista NashvilleMembersKix BrooksRonnie DunnWebsiteBrooks-Dunn.com Brooks & Dunn are an American country music duo consisting of Kix Brooks and Ronnie Dunn, both of whom are vocalists and songwriters. The duo was founded in 1990 through the suggest...

Person who presents news during a news program Anchorman and Anchorwoman redirect here. For the film, see Anchorman: The Legend of Ron Burgundy. For the film series, see Anchorman (film series). For the TV series, see Anchorwoman (TV series). For Ceremonies, see Master of ceremonies. Journalism News Writing style Ethics code of ethics Objectivity News values Attribution Defamation Sensationalism Editorial independence Journalism school Index of journalism articles Areas Arts Business Data Ent...

 

 

Lambang Negara Republik AlbaniaDetailPemangkuAlbaniaDigunakan sejak1998 Lambang negara Albania adalah lambang resmi dari Albania. Lambang ini diadaptasi dari bendera Albania, dan didasarkan dari cap Skanderbeg. Pranala luar Wikimedia Commons memiliki media mengenai Coats of arms of Albania. Albania National Emblem In The World All Countries National Emblem Diarsipkan 2007-06-29 di Wayback Machine. Artikel bertopik lambang negara ini adalah sebuah rintisan. Anda dapat membantu Wikipedia dengan...

 

 

Sebuah foto satelit yang terdiri dari pulau-pulau dan daerah kontinental di Eropa Utara. Eropa Utara merupakan sebuah sebutan bagi bagian utara Eropa, meski perbatasannya tidak tetap dan memiliki berbagai versi. Merupakan sebutan yang mengelompokkan negara Nordik (yang ditampilkan dalam semua arti): Denmark, Finlandia, Islandia, Norwegia dan Swedia, juga Åland, Kepulauan Faroe, Jan Mayen dan Svalbard. (Meski secara politik dan sejarah sangat erat dengan Eropa Utara, teritori Nordik Greenland...

Энциклопедический словарь Брокгауза и Ефрона (ЭСБЕ) Коллекция из 86 полутомов Брокгауза и Ефрона Автор см. текст Жанр универсальная энциклопедия Язык оригинала русский Оригинал издан 1907 Издатель АО «Ф. А. Брокгауз — И. А. Ефрон» Выпуск 1890—1907 Страниц 41 т�...

 

 

Pour les articles homonymes, voir Waiau. le Waiauanglais : Waiau River (Southland) Vue du Waiau dans la forêt Le Waiau et ses affluents sur une carte de l'île du Sud. Waiau River (Southland) sur OpenStreetMap. Caractéristiques Longueur 70 km Bassin collecteur le Waiau Cours Source lac Te Anau Embouchure Détroit de Foveaux · Localisation à 8 km au sud de la ville de Tuatapere · Altitude 0 m Géographie Pays traversés Nouvelle-Zélande Îles l'île du Sud Régions t...

 

 

American botanist and geneticist (1906-2000) This article is about the botanist George Ledyard Stebbins. For the American gospel song writer, see George Coles Stebbins. G. Ledyard StebbinsForMemRSBornGeorge Ledyard Stebbins Jr.(1906-01-06)January 6, 1906Lawrence, New YorkDiedJanuary 19, 2000(2000-01-19) (aged 94)Davis, CaliforniaEducationCate School, Carpinteria, California; Harvard University (Ph.D. 1931); UC BerkeleyKnown forVariation and Evolution in PlantsAwardsLinnean Medal (19...

Championship series of Major League Baseball in 1947 1947 World Series Team (Wins) Manager(s) Season New York Yankees (4) Bucky Harris 97–57, .630, GA: 12 Brooklyn Dodgers (3) Burt Shotton 94–60, .610, GA: 5DatesSeptember 30 – October 6VenueYankee Stadium (New York)Ebbets Field (Brooklyn)UmpiresBill McGowan (AL), Babe Pinelli (NL), Eddie Rommel (AL), Larry Goetz (NL), Jim Boyer (AL: outfield only), George Magerkurth (NL: outfield only)Hall of FamersUmpire: Bill McGowan Yankees...

 

 

App for learning Xi Jinping Thought You can help expand this article with text translated from the corresponding article in Chinese. (March 2023) Click [show] for important translation instructions. Machine translation, like DeepL or Google Translate, is a useful starting point for translations, but translators must revise errors as necessary and confirm that the translation is accurate, rather than simply copy-pasting machine-translated text into the English Wikipedia. Do not translate ...

 

 

Voce principale: Unione Calcio Sampdoria. UC SampdoriaStagione 2022-2023Sport calcio Squadra Sampdoria Allenatore Marco Giampaolo (1ª-8ª) Dejan Stanković (9ª-38ª) All. in seconda Francesco Conti (1ª-8ª) Nenad Sakić (9ª-38ª) Presidente Marco Lanna Serie A20º (in Serie B) Coppa ItaliaOttavi di finale Maggiori presenzeCampionato: Gabbiadini (34)Totale: Gabbiadini (35) Miglior marcatoreCampionato: Gabbiadini (7)Totale: Gabbiadini (7) StadioLuigi Ferraris (36 559) Abbonati14&...

Pour les articles homonymes, voir 44e division d'infanterie. Cet article est une ébauche concernant une unité ou formation militaire allemande. Vous pouvez partager vos connaissances en l’améliorant (comment ?) selon les recommandations des projets correspondants. Consultez la liste des tâches à accomplir en page de discussion. 44e division d'infanterie Création 1938 Dissolution Mai 1945 Pays Allemagne Allégeance Troisième Reich Branche Wehrmacht Type Division d'infanteri...

 

 

Musical literacy is the reading, writing, and playing of music, as well an understanding of cultural practice and historical and social contexts. Music literacy and music education are frequently talked about relationally and causatively, however, they are not interchangeable terms, as complete musical literacy also concerns an understanding of the diverse practices involved in teaching music pedagogy and its impact on literacy. Even then, there are those who argue[1] against the rela...

 

 

Indigenous language of the Kamëntsá people of Colombia KamëntsáCocheRegionColombiaEthnicityCamsá peopleNative speakers4,000 (2008)[1]Language familyLanguage isolateLanguage codesISO 639-3kbhGlottologcams1241ELPCamsáLocation of the Kamëntsá language speakers. Camsá (Kamsá, Kamse), also referred to as Mocoa, Sibundoy, Coche, and natively as Kamëntsá (Kamemtxa, Camëntsëá), is a language isolate and native language of the Camsá people who primarily inhabit the Sibundo...

California ranch owner (1837–1905) Ysabel del Valle in her later years, from a 1903 publication. (Ysabel del Valle with child) (12911447415) Ysabel del Valle (March 21, 1837 – March 28, 1905) was a philanthropist and rancho owner, and the matriarch of a large Californio family. She was a model for the rancho matron character Señora Moreno in Helen Hunt Jackson's novel Ramona (1884). Early life Maria Eufemia Ysabel Varela was born in Los Angeles, California, Mexico, the daughter of Cerval...

 

 

Cameron Diaz al Tribeca Film Festival (2010) Cameron Michelle Diaz (San Diego, 30 agosto 1972) è un'attrice ed ex modella statunitense, celebre per il ruolo di Mary Jensen in Tutti pazzi per Mary. Ha partecipato in seguito a molti film di successo, spaziando dal genere drammatico (Essere John Malkovich, Ogni maledetta domenica - Any Given Sunday, Vanilla Sky, Gangs of New York) a quello comico (Notte brava a Las Vegas, Bad Teacher - Una cattiva maestra). Nel corso della sua carriera ha ricev...

 

 

Чемпионат мира и Европы по хоккею с шайбой 1930 Подробности турнира Страны проведения  Франция  Германия  Австрия Города проведения Шамони, Берлин, Вена Время проведения 30 января — 10 февраля Число команд 12 Призовые места 1 Чемпион Канада (4-й титул) 2 Второе место Гер�...

Alessandro Ajmone MarsanNazionalità Italia Calcio RuoloAttaccante Termine carriera1913 CarrieraSquadre di club1 1903-1909 Juventus II1+ (?)1909-1910 Juventus1 (0)1910-1913 Pro Vercelli6+ (?) 1 I due numeri indicano le presenze e le reti segnate, per le sole partite di campionato.Il simbolo → indica un trasferimento in prestito.   Modifica dati su Wikidata · Manuale Alessandro Ajmone Marsan (Torino, 31 ottobre 1884 – Noli, 11 agosto 1941) è stato un dirigen...

 

 

Questa voce sull'argomento politici statunitensi è solo un abbozzo. Contribuisci a migliorarla secondo le convenzioni di Wikipedia. Segui i suggerimenti del progetto di riferimento. John Connally 61º Segretario al TesoroDurata mandato11 febbraio 1971 –12 giugno 1972 PresidenteRichard Nixon PredecessoreDavid M. Kennedy SuccessoreGeorge Shultz 39º Governatore del TexasDurata mandato15 gennaio 1963 –21 gennaio 1969 PredecessorePrice Daniel SuccessorePrest...