ELF4

ELF4
Ідентифікатори
Символи ELF4, ELFR, MEF, E74 like ETS transcription factor 4, AIFBL2
Зовнішні ІД OMIM: 300775 MGI: 1928377 HomoloGene: 31036 GeneCards: ELF4
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001127197
NM_001421
NM_019680
NM_001381876
RefSeq (білок)
NP_001120669
NP_001412
NP_062654
NP_001368805
Локус (UCSC) Хр. X: 130.06 – 130.11 Mb Хр. X: 47.5 – 47.55 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ELF4 (англ. E74 like ETS transcription factor 4) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі.[3] Довжина поліпептидного ланцюга білка становить 663 амінокислот, а молекулярна маса — 70 730[4].

Послідовність амінокислот
1020304050
MAITLQPSDLIFEFASNGMDDDIHQLEDPSVFPAVIVEQVPYPDLLHLYS
GLELDDVHNGIITDGTLCMTQDQILEGSFLLTDDNEATSHTMSTAEVLLN
MESPSDILDEKQIFSTSEMLPDSDPAPAVTLPNYLFPASEPDALNRAGDT
SDQEGHSLEEKASREESAKKTGKSKKRIRKTKGNRSTSPVTDPSIPIRKK
SKDGKGSTIYLWEFLLALLQDRNTCPKYIKWTQREKGIFKLVDSKAVSKL
WGKQKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKEMPKDLVVI
EDEDESSEATAAPPQASTASVASASTTRRTSSRVSSRSAPQGKGSSSWEK
PKIQHVGLQPSASLELGPSLDEEIPTTSTMLVSPAEGQVKLTKAVSASSV
PSNIHLGVAPVGSGSALTLQTIPLTTVLTNGPPASTTAPTQLVLQSVPAA
STFKDTFTLQASFPLNASFQDSQVAAPGAPLILSGLPQLLAGANRPTNPA
PPTVTGAGPAGPSSQPPGTVIAAFIRTSGTTAAPRVKEGPLRSSSYVQGM
VTGAPMEGLLVPEETLRELLRDQAHLQPLPTQVVSRGSHNPSLLGNQTLS
PPSRPTVGLTPVAELELSSGSGSLLMAEPSVTTSGSLLTRSPTPAPFSPF
NPTSLIKMEPHDI

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Mao S., Frank R.C., Zhang J., Miyazaki Y., Nimer S.D. (1999). Functional and physical interactions between AML1 proteins and an ETS protein, MEF: implications for the pathogenesis of t(8;21)-positive leukemias. Mol. Cell. Biol. 19: 3635—3644. PMID 10207087 DOI:10.1128/MCB.19.5.3635
  • Hedvat C.V., Yao J., Sokolic R.A., Nimer S.D. (2004). Myeloid ELF1-like factor is a potent activator of interleukin-8 expression in hematopoietic cells. J. Biol. Chem. 279: 6395—6400. PMID 14625302 DOI:10.1074/jbc.M307524200
  • Miyazaki Y., Sun X., Uchida H., Zhang J., Nimer S. (1996). MEF, a novel transcription factor with an Elf-1 like DNA binding domain but distinct transcriptional activating properties. Oncogene. 13: 1721—1729. PMID 8895518

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:3319 (англ.) . Процитовано 12 вересня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, Q99607 (англ.) . Архів оригіналу за 5 жовтня 2017. Процитовано 12 вересня 2017.

Див. також

Read other articles:

ЖожакJaujac   Країна  Франція Регіон Овернь-Рона-Альпи  Департамент Ардеш  Округ Ларжантьєр Кантон Тюей Код INSEE 07107 Поштові індекси 07380 Координати 44°38′16″ пн. ш. 4°15′25″ сх. д.H G O Висота 332 - 1207 м.н.р.м. Площа 24,27 км² Населення 1291 (01-2020[1]) Густота 48,78 ос./км² Р...

تحوي هذه المقالة أو هذا القسم ترجمة آلية. فضلًا، ساهم في تدقيقها وتحسينها أو إزالتها لأنها تخالف سياسات ويكيبيديا. (نقاش) (يوليو 2016) أردية الاسم الذاتي اُرْدُوْ لفظ الاسم [ˈʊrdu:] اسم اللغة في الخط النستعليقي الناطقون 65 مليون في الهند،[1]16 مليون في باكستان[2] (2007 - 2017) الد...

The following shows the public housing estates in Diamond Hill, Wong Tai Sin District, Kowloon, Hong Kong. History This section is empty. You can help by adding to it. (December 2009) Overview This section needs expansion. You can help by adding to it. (December 2009) Name Type Inaug. No Blocks No Units Notes Fung Tak Estate 鳳德邨 TPS 1991 7 1,659 Fung Chuen Court 鳳鑽苑 HOS 1991 1 612 Fung Lai Court 鳳禮苑 HOS 1997 2 690 Lung Poon Court 龍蟠苑 HOS 1987 7 3,680 Kai Chuen Court 啟

Si ce bandeau n'est plus pertinent, retirez-le. Cliquez ici pour en savoir plus. Cet article ne s'appuie pas, ou pas assez, sur des sources secondaires ou tertiaires (août 2013). Pour améliorer la vérifiabilité de l'article ainsi que son intérêt encyclopédique, il est nécessaire, quand des sources primaires sont citées, de les associer à des analyses faites par des sources secondaires. Adrien Politi Adrien PolitiInformations générales Naissance 15 octobre 1957 (66 ans)Rosario...

Ambrósio Fernandes Brandão Nascimento 1555 Morte 1618 (aprox.) Nacionalidade  Portugal Ambrósio Fernandes Brandão (Portugal, 1555 — 1618) foi um senhor de engenho e escritor português, que viveu no Brasil Colonial entre os séculos 16 e 17 e deixou a célebre obra Diálogos das grandezas do Brasil, na qual narra sua estada em terras brasileiras.[1] Cristão-novo perseguido pela Inquisição, Brandão estabeleceu-se na Paraíba, onde escreveu esses diálogos e onde também foi senh...

Pour les articles homonymes, voir Eino Leino (homonymie). Eino Leino Eino Leino en 1912 Données clés Nom de naissance Armas Einar Leopold Lönnbohm Naissance 6 juillet 1878 Paltamo, Finlande Décès 10 janvier 1926 (à 47 ans) Tuusula, Finlande Activité principale écrivain Auteur Langue d’écriture finnois modifier Eino Leino de son vrai nom Armas Einar Leopold Lönnbohm (né le 6 juillet 1878 à Paltamo en Finlande et mort le 10 janvier 1926 à Tuusula) est un des écrivains finla...

Band dari sekolah Sveio saat kejuaraan Norwegia pada tahun 2002 Band sekolah merupakan sekolompok siswa pemain musik yang berlatih dan memainkan alat musik secara bersamaan. Sebuah konser band biasanya dibawah pimpinan seorang dirigen atau lebih. Band sekolah memiliki alat musik tiup kayu dan logam serta alat musik perkusi. Meskipun band tingkat yang tingkatnya lebih tinggi mungkin juga memiliki gitar bass Band sekolah di Inggris biasanya sama dengan yang ada di Amerika, meskipun brass band y...

«Леонардо да Вінчі» Leonardo da Vinci (1939) Служба Тип/клас Підводний човен типу «Марконі» Держава прапора Королівство Італія Належність  Королівські військово-морські сили Італії Порт приписки BETASOM На честь Леонардо да Вінчі — італійського генія, одного з найбільших предст

اضغط هنا للاطلاع على كيفية قراءة التصنيف أيل العراق   حالة الحفظ   أنواع مهددة بالانقراض (خطر انقراض متوسط)[1] المرتبة التصنيفية نوع[2]  التصنيف العلمي  فوق النطاق  حيويات مملكة عليا  حقيقيات النوى مملكة  حيوان عويلم  ثنائيات التناظر مملكة فرعية...

This article or section appears to contradict itself on year of FIFA membership - in the body of the text, it is stated to be 1959, but under competitive record, it is claimed that Malta was not a FIFA member until 1970. Please see the talk page for more information. (August 2023) Men's association football team This article is about the men's team. For the women's team, see Malta women's national football team. MaltaNickname(s)Ħomor (Reds)AssociationMalta Football AssociationConfederat...

Style of Japanese architecture Ginkaku-ji's Tōgu-dō is the oldest extant example of shoin-zukuri. Shoin-zukuri (書院造) is a style of Japanese residential architecture used in the mansions of the military, temple guest halls, and Zen abbot's quarters of the Muromachi (1336-1573), Azuchi–Momoyama (1568–1600) and Edo periods (1600–1868). It forms the basis of today's traditional-style Japanese house. Characteristics of the shoin-zukuri development were the incorporation of square p...

Historical police departmentThis article does not cite any sources. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Los Angeles General Services Police – news · newspapers · books · scholar · JSTOR (May 2020) (Learn how and when to remove this template message) For other law enforcement agencies in Los Angeles County, see Law enforcement in Los Angeles County. Los ...

Revenue service of the Romanian government This article relies largely or entirely on a single source. Relevant discussion may be found on the talk page. Please help improve this article by introducing citations to additional sources.Find sources: National Agency for Fiscal Administration – news · newspapers · books · scholar · JSTOR (February 2020) National Agency for Fiscal Administration(ANAF)CoatAgency overviewFormed1 October 2003JurisdictionRomân...

2011 Canadian filmBeat the WorldInternational theatrical release posterDirected byRobert AdetuyiWritten byRobert AdetuyiProduced byAmos AdetuyiStarringTyrone BrownMishael MorganNikki GrantAli KazmiKristy FloresCinematographyHubert TaczanowskiEdited byRonald SandersMike LeeMusic byAndrew LockingtonDistributed byInnerCity FilmsRelease date May 13, 2011 (2011-05-13) Running time91 minutesCountryCanadaLanguageEnglishBox office$933,540[1] Beat the World (also known as You Go...

This article is about the New Zealand current affairs TV show. For the Mike Holmes renovation TV shows, see Mike Holmes. The name of this television news uses a disambiguation style that does not follow WP:NCTV or WP:NCBC and needs attention. If you are removing this template without fixing the naming style to one supported by WP:NCTV, please add the article to Category:Television articles with disputed naming style. New Zealand TV series or program HolmesTitle Card, 1997StarringPaul Hol...

Type of signal box in railway signalling Block post, HDM, in the centre of the Hindenburgdamm (1978) A block post in railway signalling is the signal box at one end of a block section.[1] German practice In Germany, block posts are known as Blockstellen (abbreviation: Bk) and are defined as railway facilities on the open line that mark the end of a block section, as part of a block system. They usually have a home signal in each direction and on each running line. They are mainly foun...

French sex museum in ParisMusée de l'érotisme, 72 boulevard de Clichy in the 18th arrondissementMuseum of Eroticism (French: Musée de l'érotisme) was a sex museum in Paris devoted to the erotic art collections of antique dealer Alain Plumey and French teacher Jo Khalifa. It closed its doors on November 7, 2016. History Founded in 1997, the museum was situated in the Pigalle district of Paris, at 72 Boulevard de Clichy.[1] The collection ranged from the ancient religious art of Ind...

This biography of a living person needs additional citations for verification. Please help by adding reliable sources. Contentious material about living persons that is unsourced or poorly sourced must be removed immediately from the article and its talk page, especially if potentially libelous.Find sources: Ralf Schmitz – news · newspapers · books · scholar · JSTOR (December 2011) (Learn how and when to remove this template message) German comedian an...

Hundreds of Empire ships were employed by the Government of the United Kingdom.[1] They were acquired from a number of sources: many were built for the government; others obtained from the United States; still others were captured or seized from enemy powers. Empire ships were mostly used during World War II by the Ministry of War Transport (MoWT), which owned the ships but contracted out their management to various shipping lines; however, some ships requisitioned during the Suez Cri...

Hospital in Surrey, EnglandEast Surrey HospitalSurrey and Sussex Healthcare NHS TrustEntrance to East Surrey HospitalShown in SurreyGeographyLocationRedhill, Surrey, EnglandCoordinates51°13′08″N 0°09′51″W / 51.2188°N 0.1643°W / 51.2188; -0.1643OrganisationCare systemNational Health ServiceTypeGeneralAffiliated universityBrighton and Sussex Medical SchoolPatronNoneServicesEmergency departmentYesBeds697[1]HistoryOpened1979; 44 years ago&#...