NR1H4

NR1H4
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NR1H4, BAR, FXR, HRR-1, HRR1, RIP14, nuclear receptor subfamily 1 group H member 4, PFIC5
Зовнішні ІД OMIM: 603826 MGI: 1352464 HomoloGene: 3760 GeneCards: NR1H4
Реагує на сполуку
chenodiol, fexaramine, obeticholic acid, (E)-guggulsterone[1]
nidufexor[2]
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001163504
NM_001163700
NM_009108
NM_001385711
RefSeq (білок)
NP_001156976
NP_001157172
NP_033134
NP_001372640
Локус (UCSC) Хр. 12: 100.47 – 100.56 Mb Хр. 10: 89.29 – 89.37 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NR1H4 (англ. Nuclear receptor subfamily 1 group H member 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[5] Довжина поліпептидного ланцюга білка становить 486 амінокислот, а молекулярна маса — 55 914[6].

Послідовність амінокислот
1020304050
MVMQFQGLENPIQISPHCSCTPSGFFMEMMSMKPAKGVLTEQVAGPLGQN
LEVEPYSQYSNVQFPQVQPQISSSSYYSNLGFYPQQPEEWYSPGIYELRR
MPAETLYQGETEVAEMPVTKKPRMGASAGRIKGDELCVVCGDRASGYHYN
ALTCEGCKGFFRRSITKNAVYKCKNGGNCVMDMYMRRKCQECRLRKCKEM
GMLAECMYTGLLTEIQCKSKRLRKNVKQHADQTVNEDSEGRDLRQVTSTT
KSCREKTELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLI
LTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIF
NKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLT
AIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGR
LTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ

Кодований геном білок за функціями належить до репресорів, рецепторів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як імунітет, вроджений імунітет, транскрипція, регуляція транскрипції, запальна відповідь, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004.  PMID 15489334 DOI:10.1101/gr.2596504
  • Kanaya E., Shiraki T., Jingami H. (2004). The nuclear bile acid receptor FXR is activated by PGC-1alpha in a ligand-dependent manner. Biochem. J. 382: 913—921.  PMID 15202934 DOI:10.1042/BJ20040432
  • Neimark E., Chen F., Li X., Shneider B.L. (2004). Bile acid-induced negative feedback regulation of the human ileal bile acid transporter. Hepatology. 40: 149—156.  PMID 15239098 DOI:10.1002/hep.20295
  • Pineda Torra I., Freedman L.P., Garabedian M.J. (2004). Identification of DRIP205 as a coactivator for the Farnesoid X receptor. J. Biol. Chem. 279: 36184—36191.  PMID 15187081 DOI:10.1074/jbc.M405126200
  • Hirokane H., Nakahara M., Tachibana S., Shimizu M., Sato R. (2004). Bile acid reduces the secretion of very low density lipoprotein by repressing microsomal triglyceride transfer protein gene expression mediated by hepatocyte nuclear factor-4. J. Biol. Chem. 279: 45685—45692.  PMID 15337761 DOI:10.1074/jbc.M404255200
  • Ananthanarayanan M., Li S., Balasubramaniyan N., Suchy F.J., Walsh M.J. (2004). Ligand-dependent activation of the farnesoid X-receptor directs arginine methylation of histone H3 by CARM1. J. Biol. Chem. 279: 54348—54357.  PMID 15471871 DOI:10.1074/jbc.M410021200

Примітки

Див. також

Read other articles:

School in BangladeshHaidrabad Hazi E. A. B. High Schoolহায়দরাবাদ হাজী ই. এ. বি. উচ্চ বিদ্যালয়AddressHazi Eakub Ali Bhuiyan Road, Haidarabad, Muradnagar UpazilaComilla District3543BangladeshCoordinates23°45′40″N 91°01′24″E / 23.7610°N 91.0234°E / 23.7610; 91.0234InformationMottoপ্রভু জ্ঞান দাও(God give us knowledge )Established1986 (1986)FounderHazi Eakub Ali Bhui...

 

Kacang bogor Kacang bogor, Vigna subterraneadari Pasar Semplak Kapuk, Bogor Klasifikasi ilmiah Kerajaan: Plantae (tanpa takson): Angiospermae (tanpa takson): Eudikotil (tanpa takson): Fabids Ordo: Fabales Famili: Fabaceae Subfamili: Faboideae Tribus: Phaseoleae Genus: Vigna Spesies: V. subterranea Nama binomial Vigna subterranea(L.) Verdc.[1] Sinonim Glycine subterranea L.[2] Voandzeia subterranea (L.) Thouars Voandzeia subterranea (L.) DC Sumber: The Plant List[3 ...

 

Akromegali pada Tangan Akromegali adalah suatu penyakit di mana seseorang mengalami kelainan pada jumlah hormon pertumbuhan yang berlebihan.[1] Akromegali disebabkan oleh kelenjar hipofisis yang terlalu banyak memproduksi hormon pertumbuhan dari waktu ke waktu.[2] Hipofisis sendiri merupakan kelenjar kecil yang terletak di dasar otak di belakang batang hidung dan menghasilkan sejumlah hormon.[2] Hormon pertumbuhan ini memainkan peran penting dalam mengelola pertumbuhan...

American politician Margaret Kelly33rd Auditor of Missouri[1]In officeJuly 16, 1984 – January 1999Preceded byJames AntonioSucceeded byClaire McCaskill[1] Personal detailsBorn (1935-09-17) September 17, 1935 (age 88)Crystal City, Missouri, U.S.Political partyRepublicanEducationUniversity of Missouri (BS)Missouri State University (MBA) Margaret Blake Kelly (born September 17, 1935)[2] is an American former politician and accountant from Missouri. Kelly se...

 

Artikel ini bukan mengenai Intel, sebuah perusahaan teknologi Amerika Serikat. Itel MobileLogo baru Itel yang pertama kali digunakan di Indonesia sejak 5 Oktober 2023JenisAnak perusahaanIndustriElektronikDidirikanMaret 2014[1]KantorpusatShenzhen,[2] TiongkokTokohkunciLei Weiguo (pendiri/Direktur Utama)ProdukTelepon selular, tablet, pesawat televisi, laptop, aksesoriIndukTranssion HoldingsSitus webwww.itel-life.com Logo pertama Itel Mobile itel Mobile adalah perusahaan produsen...

 

روبرتو بوسكايليا معلومات شخصية الميلاد 24 مايو 1968 (العمر 55 سنة)[1]جيلا  مركز اللعب وسط الجنسية إيطاليا  معلومات النادي النادي الحالي فوجيا (مدرب) المسيرة الاحترافية  سنواتفريقمبارياتأهداف1999–2000 Enna Calcio Società Cooperativa Sportiva Dilettantistica - [تعديل القيم في ويكي بيانات] الف�...

Emma GoldmanEmma, c. 1911Lahir(1869-06-27)27 Juni 1869Kovno, Governorat Kovno, Imperium RusiaMeninggal14 Mei 1940(1940-05-14) (umur 70)Toronto, Ontario, KanadaAliranAnarkismefeminisme Dipengaruhi Friedrich NietzscheJohann MostHenry David ThoreauRalph Waldo EmersonPeter KropotkinMikhail BakuninMary WollstonecraftNikolay ChernyshevskyOscar WildeMax Stirner Memengaruhi Roger Nash BaldwinBa JinNoe Ito[1]Margaret Sanger Tanda tangan Bagian dari seri politik tentangAnarkisme Aliran pe...

 

Born to Run adalah sebuah seri drama televisi Tiongkok tahun 2024 yang disutradarai oleh Shen Yan. Seri tersebut menampilkan Zhong Chuxi sebagai Cheng Anxin, Yang Chaoyue sebagai Chen Ruohua, Zhao Xiufang sebagai Xu Di, Zhao Xiuli, sebagai Chen Xiaoyi, Hou Wenyuan sebagai Lin Tianyu, Wang Youjun sebagai Zhou Kaize, Li Tiannuo sebagai Li Zhong, dan Song Yang sebagai Qin Feng. Seri tersebut terdiri dari 28 episode dan ditayangkan di di iQIYI.[1] Sinopsis Zhao Xiu Fang dan Zhao Xiu Li ad...

 

7.62×51 ملم ناتو   بلد الأصل الولايات المتحدة  فترة الاستخدام بداية:1954  المستخدمون حلف شمال الأطلسي  الحروب حرب فيتنام  الطول 51.07 مليمتر[1]،  و71.00 مليمتر[1]  القطر 7.66 مليمتر[1]،  و8.59 مليمتر[1]،  و11.43 مليمتر[1]،  و11.88 مليمتر[1]،  و11.90...

Théâtre municipal de FontainebleauLe théâtre et sa cour, vus depuis les escaliers à l'entrée, en mai 2021.PrésentationType ThéâtreFondation 1905Orientation Sud-estStyle Style Louis XIIIArchitectes Fernand Lucas (d), Paul Marion (d)Matériau brique et pierreOuverture 9 mars 1912Restauration 1991 et 2011Propriétaire Ville de Fontainebleau (d)Patrimonialité Inscrit MH (1991)LocalisationAdresse 6 rue Denecourt (d) Fontainebleau, Seine-et-Marne FranceCoordonnées 48° 24�...

 

Persian military commander (died 479 BC) For other uses, see Mardonius (disambiguation). Mardonius (Old Persian: 𐎶𐎼𐎯𐎢𐎴𐎡𐎹 Mr̥duniyaʰ; Greek: Μαρδόνιος Mardónios;[1] died 479 BC) was a leading Persian military commander during the Persian Wars with Greece in the early 5th century BC who died at the Battle of Plataea. Early years Gobryas, father of Mardonius, on the tomb of Darius I.[2] Mardonius was the son of Gobryas, a Persian nobleman who had ...

 

Subgenre of American country music This article is about the musical subgenre. For the dance, see Lindy Hop. For other uses, see West Coast Swing. Western swingStylistic originsSwingDixielandWesterncountrybluesold-timestring bandsCultural origins1920s–1930s, Southwestern United StatesDerivative formsNeotraditional countryFusion genresTexas swingRockabillyrock and roll Western swing is a subgenre of American country music that originated in the late 1920s in the West and South among the reg...

National association football team This article is about the men's team. For the women's team, see Gabon women's national football team. GabonNickname(s)Les Panthères (The Panthers)AssociationGabonese Football Federation (Fédération Gabonaise de Football, FEGAFOOT)ConfederationCAF (Africa)Sub-confederationUNIFFAC (Central Africa)Head coachThierry MouyoumaCaptainPierre-Emerick AubameyangMost capsDidier Ovono (112)Top scorerPierre-Emerick Aubameyang (31)Home stadiumStade d'AngondjéFIFA code...

 

Une voie veineuse centrale est un dispositif médical visant à cathétériser une veine de gros calibre. Ce système permet d'injecter des médicaments à un malade mais aussi, dans certains cas, de mesurer la pression veineuse centrale. Matériel et technique Set de pose de voie veineuse centrale. Il existe plusieurs types de cathéters centraux : les cathéters pour perfusion (une, deux, trois, quatre ou cinq voies de perfusion), les cathéters à visée diagnostique (type Swan-Ganz) ...

 

زهراء كاظمي   معلومات شخصية الميلاد سنة 1949   شيراز  الوفاة 11 يوليو 2003 (53–54 سنة)  سبب الوفاة الصدمة الرضية الحادة  مواطنة كندا (العقد 1990–) إيران  الحياة العملية المدرسة الأم جامعة باريس  المهنة مصورة،  وصحافية،  ومراسل صحفي،  ومصورة أخبار  اللغا�...

Campeonato MineiroSport Calcio Tiposquadre di club FederazioneFMF Parte diCBF Paese Minas Gerais, Brasile TitoloCampione dello stato di Minas Gerais Cadenzaannuale Partecipanti12 Retrocessione inMódulo II Sito Internetwww.fmfnet.com.br StoriaFondazione1915 Detentore Atlético Mineiro Record vittorie Atlético Mineiro (49) Trofeo o riconoscimento Modifica dati su Wikidata · Manuale Il Campeonato Mineiro è il campionato di calcio dello stato di Minas Gerais, in Brasi...

 

Disambiguazione – Se stai cercando altri significati, vedi Vespri siciliani (disambigua). Vespri sicilianiparte delle Guerre del VesproDrouet trafitto dalla spada viene ucciso, da I Vespri siciliani di Francesco Hayez (Galleria nazionale d'arte moderna e contemporanea, Roma)Data30 marzo - 22 maggio 1282 LuogoSicilia Modifiche territorialiLiberazione della Sicilia Effettivi Ribelli siciliani Casa d'Angiò PerditeIgnote, trascurabili4.000 francesi uccisi Voci di guerre presenti su Wikipedia ...

 

Cet article est une ébauche concernant l’Alaska. Vous pouvez partager vos connaissances en l’améliorant (comment ?) selon les recommandations des projets correspondants. Photo satellite de Landsat 7 avec fausses couleurs du North Slope et de la banquise. L’Alaska North Slope (que l'on pourrait traduire par le Versant nord de l'Alaska) est une région de l'Alaska située sur le flanc nord de la chaîne Brooks le long de la côte de l'océan Arctique, principalement habitée par l...

Town in Central Bohemian, Czech RepublicPyšelyTownChurch of the Exaltation of the Holy Cross FlagCoat of armsPyšelyLocation in the Czech RepublicCoordinates: 49°52′30″N 14°40′42″E / 49.87500°N 14.67833°E / 49.87500; 14.67833Country Czech RepublicRegionCentral BohemianDistrictBenešovFirst mentioned1295Government • MayorŠtěpánka BednářováArea • Total12.81 km2 (4.95 sq mi)Elevation372 m (1,220 ft)P...

 

Digital printing technology with wide color range This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Dye-sublimation printing – news · newspapers · books · scholar · JSTOR (April 2020) (Learn how and when to remove this message) Part of a series on theHistory of printing TechniquesWoodblock printing200Movable ...