OR4E2

OR4E2
Ідентифікатори
Символи OR4E2, OR14-42, olfactory receptor family 4 subfamily E member 2, olfactory receptor family 4 subfamily E member 2 (gene/pseudogene)
Зовнішні ІД MGI: 3031343 HomoloGene: 41378 GeneCards: OR4E2
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001001912
NM_020514
RefSeq (білок)
NP_001001912
NP_001001912
NP_065260
Локус (UCSC) Хр. 14: 21.65 – 21.67 Mb Хр. 14: 52.68 – 52.69 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

OR4E2 (англ. Olfactory receptor 4E2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 313 амінокислот, а молекулярна маса — 35 466[4].

Послідовність амінокислот
1020304050
MDSLNQTRVTEFVFLGLTDNRVLEMLFFMAFSAIYMLTLSGNILIIIATV
FTPSLHTPMYFFLSNLSFIDICHSSVTVPKMLEGLLLERKTISFDNCITQ
LFFLHLFACAEIFLLIIVAYDRYVAICTPLHYPNVMNMRVCIQLVFALWL
GGTVHSLGQTFLTIRLPYCGPNIIDSYFCDVPLVIKLACTDTYLTGILIV
TNSGTISLSCFLAVVTSYMVILVSLRKHSAEGRQKALSTCSAHFMVVALF
FGPCIFIYTRPDTSFSIDKVVSVFYTVVTPLLNPFIYTLRNEEVKSAMKQ
LRQRQVFFTKSYT

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Локалізований у клітинній мембрані, мембрані.

Література

  • Malnic B., Godfrey P.A., Buck L.B. (2004). The human olfactory receptor gene family. Proc. Natl. Acad. Sci. U.S.A. 101: 2584—2589. PMID 14983052 DOI:10.1073/pnas.0307882100
  • Malnic B., Godfrey P.A., Buck L.B. (2004). Proc. Natl. Acad. Sci. U.S.A. 101: 7205—7205. {{cite journal}}: Пропущений або порожній |title= (довідка)

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:8297 (англ.) . Процитовано 11 вересня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, Q8NGC2 (англ.) . Архів оригіналу за 4 грудня 2016. Процитовано 11 вересня 2017.

Див. також

Read other articles:

1928 film Three Week-Endslobby cardDirected byClarence G. BadgerWritten byAdaptation:John FarrowTitles:Paul PerezHerman J. Mankiewicz[1]Screenplay byLouise LongPercy HeathSam Mintz[1]Story byElinor Glynn[1]StarringClara BowNeil HamiltonCinematographyHarold RossonEdited byTay MalarkeyProductioncompanyParamount Famous Lasky Corp.[1]Distributed byParamount Famous Lasky Corp.[1]Release date December 8, 1928 (1928-12-08) (NYC) Running time...

United States historic placeGage Group—Ascher, Keith, and Gage BuildingsU.S. National Register of Historic PlacesU.S. Historic districtContributing propertyChicago Landmark Gage Group Buildings (left to right: 30, 24, and 18 S. Michigan Avenue); the rightmost's façade is by Louis Sullivan.LocationChicago, IllinoisCoordinates41°52′52.36″N 87°38′13.01″W / 41.8812111°N 87.6369472°W / 41.8812111; -87.6369472Built1898ArchitectHolabird & Roche; Sullivan, L...

Snake-like curve This article is about the design feature. For the mathematical concept, see Serpentine curve. Serpentine lines in a plate from The Analysis of Beauty by William Hogarth A serpentine shape is any of certain curved shapes of an object or design, which are suggestive of the shape of a snake (the adjective serpentine is derived from the word serpent). Serpentine shapes occur in architecture, in furniture, and in mathematics. In architecture and urban design Serpentine walls at th...

У Вікіпедії є статті про інші значення цього терміна: Дуб Шевченка. Дуб Т. Г. Шевченка Назва на честь Шевченко Тарас ГригоровичКраїна  УкраїнаРозташування Україна,Черкаська область, Черкаський районПлоща 0,2Засновано 1972Оператор Шевченківський національний заповідникП

Best International ActressAACTA AwardCurrent recipient: Cate BlanchettCountryAustraliaPresented byAustralian Academy of Cinema and Television Arts (AACTA)First awarded2012Currently held byCate Blanchett, Tár (2022)Websitehttp://www.aacta.org The AACTA International Award for Best Lead Actress is an award that is presented by the Australian Academy of Cinema and Television Arts (AACTA), for a performance by a female actor in a film made outside Australia. It was first handed out by the Academ...

Misteri Toko AntikGenre Drama Misteri Horor PembuatMD EntertainmentPemeran Aditya Suryo Saputro Nadia Celia Yuniza Icha Nafa Urbach Ponco Buwono Dicky Wahyudi Tarzan Ibnu Ibrahim Hasan Elnino Fiona Fachru Nisa Baron Yusuf Siregar Penggubah lagu temaNicky AstriaLagu pembukaGelombang Kehidupan — Nicky AstriaLagu penutupGelombang Kehidupan — Nicky AstriaNegara asalIndonesiaBahasa asliBahasa IndonesiaJmlh. musim1Jmlh. episode4 (daftar episode)ProduksiProduser Dhamoo Punjabi Manoj Punjabi Peng...

Islam menurut negara Afrika Aljazair Angola Benin Botswana Burkina Faso Burundi Kamerun Tanjung Verde Republik Afrika Tengah Chad Komoro Republik Demokratik Kongo Republik Kongo Djibouti Mesir Guinea Khatulistiwa Eritrea Eswatini Etiopia Gabon Gambia Ghana Guinea Guinea-Bissau Pantai Gading Kenya Lesotho Liberia Libya Madagaskar Malawi Mali Mauritania Mauritius Maroko Mozambik Namibia Niger Nigeria Rwanda Sao Tome dan Principe Senegal Seychelles Sierra Leone Somalia Somaliland Afrika Selatan ...

Overview of video gaming in China Games market of China by revenue per platform in 2015[1] The video game industry in Mainland China currently is one of the major markets for the global video game industry, where more than half a billion people play video games. Revenues from China make up around 25% of nearly US$100 billion video game industry as of 2018, and since 2015 has exceeded the contribution to the global market from the United States.[2] Because of its market size, C...

Australian rules footballer Australian rules footballer Harry Moyes Personal informationFull name Harold Milne MoyesDate of birth 28 July 1896Place of birth Prahran, VictoriaDate of death 18 September 1968(1968-09-18) (aged 72)Place of death Fairfield, VictoriaOriginal team(s) South YarraHeight 170 cm (5 ft 7 in)Weight 66 kg (146 lb)Playing career1Years Club Games (Goals)1915, 1919–24 St Kilda 061 (128)1925–27 Melbourne 045 (106)Total 106 (234) 1 Playing...

American reality television series For the British version of the show, see Celebrity Fit Club. This article does not cite any sources. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Celebrity Fit Club American TV series – news · newspapers · books · scholar · JSTOR (February 2010) (Learn how and when to remove this template message) Celebrity Fit ClubDirecte...

This article may require copy editing for grammar, style, cohesion, tone, or spelling. You can assist by editing it. (December 2022) (Learn how and when to remove this template message) Public university in Kharkiv, Ukraine Simon Kuznets Kharkiv National University of EconomicsХарківський національний економічний університет ім. Семена КузнецяMottoDiscere, cogitare, laborare docemus.Motto in EnglishWe teach to learn, to think, t...

Canadian professional wrestler Shawn SpearsSpears in July 2019Birth nameRonnie William ArneillBorn (1981-02-19) February 19, 1981 (age 42)St. Catharines, Ontario, CanadaSpouse(s) Cassie Lee ​(m. 2019)​Children1Professional wrestling careerRing name(s)Gavin Spears[1]Shawn SpearsStanTye Dillinger[2]Billed height6 ft 3 in (1.91 m)[2]Billed weight223 lb (101 kg)[2]Billed fromNiagara Falls, Ontario, Canada&#...

This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Dar Djaït – news · newspapers · books · scholar · JSTOR (November 2016) (Learn how and when to remove this template message) Darjaiet 06 Dar Djaït is an old palace of the Medina of Tunis. It is located in the Street of Sidi ben Arous. History The family of Dj...

Vous lisez un « article de qualité » labellisé en 2007. Pour les articles homonymes, voir Queen (homonymie). Queen Haut : Brian May, Freddie Mercury Bas : John Deacon, Roger TaylorInformations générales Pays d'origine Royaume-Uni Genre musical Rock Hard rock Rock progressif Glam rock Opéra-rock Arena rock Pop rock Art rock Instruments piano, synthétiseur, guitare électrique, guitare acoustique, guitare basse et batterie Années actives Depuis 1970[1],[2] Labels Ca...

Unta arab Status konservasi Dijinakkan Klasifikasi ilmiah Kerajaan: Animalia Filum: Chordata Kelas: Mammalia Ordo: Artiodactyla Famili: Camelidae Genus: Camelus Spesies: C. dromedarius Nama binomial Camelus dromedariusLinnaeus, 1758 Unta arab (Camelus dromedarius) adalah unta dengan satu punuk di punggungnya. Habitat alaminya tidak jelas, tetapi kemungkinan di Semenanjung Arab. Domestikasi unta arab muncul secara luas di Afrika bagian utara dan Timur Tengah.[1] Australia satu-sat...

This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Sutherland Hospital – news · newspapers · books · scholar · JSTOR (August 2014) (Learn how and when to remove this template message) Hospital in NSW, AustraliaSutherland HospitalSouth Eastern Sydney Local Health DistrictSutherland HospitalGeographyLocationCarin...

Civil War in Vietnam Part of a series on the History of Vietnam Prehistoric Paleolithic Sơn Vi culture 20,000 BC–12,000 BC Mesolithic Hoabinhian 12,000 BC–10,000 BC Neolithic Bắc Sơn culture 10,000 BC–8,000 BC Quỳnh Văn culture 8,000 BC–6,000 BC Đa Bút culture 4,000 BC–3,000 BC Ancient Hồng Bàng dynasty 2879 BC–258 BC Thục dynasty 257 BC–179 BC Triệu dynasty 204 BC–111 BC Dominated 1st Chinese domination 111 BC–40 AD Trung sisters' rebellion 40–43 2nd Chine...

Dialect of Marwari Not to be confused with the Mewati language and Marwari language, also of Rajasthan, or the Newari language of Nepal. Mewariमेवाड़ी/મેવ઼ાડ઼ીNative toIndiaRegionMewarNative speakers4.21 million (2011 census)[1]Language familyIndo-European Indo-IranianIndo-AryanWesternRajasthaniMarwariMewariWriting systemDevanagariLanguage codesISO 639-3mtrGlottologmewa1249 Rajasthani language and geographical distribution of its dialects Mewari...

Artikel ini perlu diwikifikasi agar memenuhi standar kualitas Wikipedia. Anda dapat memberikan bantuan berupa penambahan pranala dalam, atau dengan merapikan tata letak dari artikel ini. Untuk keterangan lebih lanjut, klik [tampil] di bagian kanan. Mengganti markah HTML dengan markah wiki bila dimungkinkan. Tambahkan pranala wiki. Bila dirasa perlu, buatlah pautan ke artikel wiki lainnya dengan cara menambahkan [[ dan ]] pada kata yang bersangkutan (lihat WP:LINK untuk keterangan lebih lanjut...

Фолькетингдан. Folketinget     Загальна інформація: Юрисдикція:  Данія Тип: однопалатний парламент Дата заснування: 1849 Структура: Депутатів: 179 Політичнігрупи:        Соціал-демократи (50)      Венстре (23)      Помірковані (16)      Соціа...