OR11H6

OR11H6
Ідентифікатори
Символи OR11H6, olfactory receptor family 11 subfamily H member 6
Зовнішні ІД MGI: 3030579 HomoloGene: 27116 GeneCards: OR11H6
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001004480
NM_146299
RefSeq (білок)
NP_001004480
NP_666411
Локус (UCSC) Хр. 14: 20.22 – 20.22 Mb Хр. 14: 50.88 – 50.88 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

OR11H6 (англ. Olfactory receptor family 11 subfamily H member 6) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 330 амінокислот, а молекулярна маса — 36 788[4].

Послідовність амінокислот
1020304050
MFFIIHSLVTSVFLTALGPQNRTMHFVTEFVLLGFHGQREMQSCFFSFIL
VLYLLTLLGNGAIVCAVKLDRRLHTPMYILLGNFAFLEIWYISSTVPNML
VNILSEIKTISFSGCFLQFYFFFSLGTTECFFLSVMAYDRYLAICRPLHY
PSIMTGKFCIILVCVCWVGGFLCYPVPIVLISQLPFCGPNIIDHLVCDPG
PLFALACISAPSTELICYTFNSMIIFGPFLSILGSYTLVIRAVLCIPSGA
GRTKAFSTCGSHLMVVSLFYGTLMVMYVSPTSGNPAGMQKIITLVYTAMT
PFLNPLIYSLRNKDMKDALKRVLGLTVSQN

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Локалізований у клітинній мембрані, мембрані.

Література

  • Malnic B., Godfrey P.A., Buck L.B. (2004). The human olfactory receptor gene family. Proc. Natl. Acad. Sci. U.S.A. 101: 2584—2589. PMID 14983052 DOI:10.1073/pnas.0307882100
  • Malnic B., Godfrey P.A., Buck L.B. (2004). Proc. Natl. Acad. Sci. U.S.A. 101: 7205—7205. {{cite journal}}: Пропущений або порожній |title= (довідка)

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:15349 (англ.) . Архів оригіналу за 16 березня 2016. Процитовано 11 вересня 2017.
  4. UniProt, Q8NGC7 (англ.) . Архів оригіналу за 2 грудня 2016. Процитовано 11 вересня 2017.

Див. також

Read other articles:

Head of government of Tajikistan Prime Minister of theRepublic of TajikistanEmblem of TajikistanIncumbentKokhir Rasulzodasince 23 November 2013StylePrime Minister (informally)His Excellency (international correspondence)ResidenceDushanbeAppointerThe PresidentInaugural holderIzatullo KhayoyevFormation25 June 1991 Politics of Tajikistan CIS Member State Constitution Human rights Government President (list) Emomali Rahmon Prime Minister Kokhir Rasulzoda Cabinet Legislature Supreme Assembly ...

Джерело № 1(Ужок) 48°59′27″ пн. ш. 22°52′19″ сх. д. / 48.990917° пн. ш. 22.872139° сх. д. / 48.990917; 22.872139Координати: 48°59′27″ пн. ш. 22°52′19″ сх. д. / 48.990917° пн. ш. 22.872139° сх. д. / 48.990917; 22.872139Країна  УкраїнаРозташування  УкраїнаЗа

GreeceNickname(s)Hellas (Ελλάς)AssociationHellenic Ice Sports FederationHead coachGrigoris ApostolidisCaptainDimitrios KalyvasMost gamesOrestis Tilios (41)Top scorerDimitrios Kalyvas (26)Most pointsDimitrios Kalyvas (55)Team colors   IIHF codeGRE Home colours Away colours RankingCurrent IIHFNR (28 May 2023)[1]Highest IIHF44 (first in 2011)Lowest IIHF49 (first in 2015)First international Greece 15–3 Turkey  (Johannesburg, South Africa; 21 March 1992)Biggest w...

Alegoría de la primavera(Allegoria della primavera) Año c. 1477-1478Autor Sandro BotticelliTécnica Temple sobre tablaEstilo RenacimientoTamaño 203 cm × 314 cmLocalización Galería Uffizi, Florencia, Italia Italia[editar datos en Wikidata] Alegoría de la primavera (en italiano: Allegoria della primavera), más conocido simplemente como La primavera, es un cuadro realizado por el pintor Sandro Botticelli, una de las obras maestras del artista renacentista italiano. Está r...

Retrato de Manuel Bartolomé Cossío (hacia 1920), por el fotógrafo José Padró (1900-1931), en su estudio de la calle Huertas de Madrid. Conservado en la Casa Museo de Unamuno (Repositorio Documental de la Universidad de Salamanca). Las Misiones Pedagógicas fueron un proyecto de solidaridad cultural patrocinado por el Gobierno de la Segunda República Española a través del Ministerio de Instrucción Pública y Bellas Artes y desde las plataformas del Museo Pedagógico Nacional y la Inst...

2018 Indian filmPanjumittaiPosterDirected byS. P. MohanWritten byS. P. MohanProduced byRamesh KVS.GaneshVinodh KumarStarringMa Ka Pa AnandNikhila VimalSendrayanCinematographyMagesh K DevEdited byRam SudharsanMusic byD. ImmanProductioncompanyDeepam CinemaRelease date 1 June 2018 (2018-06-01) Running time140 minutesCountryIndiaLanguageTamil Panjumittai (lit. 'Cotton candy') is a 2018 Tamil language fantasy comedy film written and directed by debutant S. P. Mohan (also k...

Місто Бауерсангл. Bowers Координати 39°03′36″ пн. ш. 75°23′54″ зх. д. / 39.06000000002777739° пн. ш. 75.39860000002778406° зх. д. / 39.06000000002777739; -75.39860000002778406Координати: 39°03′36″ пн. ш. 75°23′54″ зх. д. / 39.06000000002777739° пн. ш. 75.39860000002778406° зх. д. / 39....

Para otros usos de este término, véase Lanín (desambiguación). Volcán Lanín Localización geográficaContinente AméricaÁrea protegida Parque nacional LanínCordillera de los AndesCoordenadas 39°37′58″S 71°29′59″O / -39.632777777778, -71.499722222222Localización administrativaPaís  ArgentinaChile ChileLocalización  Neuquén (ARG)Región de La Araucanía (CHI)ActivoCaracterísticas generalesTipo EstratovolcánAltitud 3776 m s. n. m.Prominencia...

American Indologist (born 1940) Wendy Doniger O'FlahertyWendy Doniger in May 2015BornWendy Doniger (1940-11-20) November 20, 1940 (age 83)New York City, New York, U.S.CitizenshipUnited StatesAlma materRadcliff College (BA)Harvard University (PhD)Oxford University (DPhil)Scientific careerFieldsSanskrit literatureHinduismMythologyHistory of ReligionsInstitutionsUniversity of ChicagoDoctoral advisorDaniel H. H. Ingalls, Sr. (Harvard)R.C.Zaehner (Oxford)Doctoral studentsJeffrey Kripal, ...

مدرسة إنهاء هي مدرسة للشابات تركز على تدريس السمو الاجتماعي والطقوس الثقافية العليا كتحضير للتعامل مع المجتمع.[1][2][3] ويعكس هذا الاسم أنه يتبع من المدرسة العادية ويهدف إلى إكمالهم التعليم مع فصول في المقام الأول على كيفية التصرف وآداب السلوك، مع المواد الأك�...

Portrait of Kyra Vassiliki, 1850 Vassiliki Kontaxi, nicknamed Kyra Vassiliki[1] (Greek: Κυρά Βασιλική, Lady Vassiliki, 1789–1834), was an influential Greek woman brought up in the seraglio of the Ottoman ruler Ali Pasha. Life Kyra Vassiliki and Ali Pasha, school of Paul Emil Jacobs, 1844 Vassiliki Kontaxi was born in the Greek village of Plisivitsa in Thesprotia. At the age of twelve she sought an audience with the local Ottoman ruler, Ali Pasha, to intercede for her fat...

19th century American lawyer, 2nd Attorney General of Wisconsin, Union Army officer. S. Park Coon2nd Attorney General of WisconsinIn officeJanuary 7, 1850 – January 5, 1852GovernorNelson DeweyPreceded byJames S. BrownSucceeded byExperience EstabrookDistrict Attorney of Milwaukee County, WisconsinIn officeJanuary 1, 1863 – January 1, 1865Preceded byJoshua StarkSucceeded byJedd P. C. Cottrill Personal detailsBorn(1820-03-28)March 28, 1820Covington, New YorkDiedOctober ...

يو-87 الجنسية  ألمانيا النازية الشركة الصانعة فليندر فيرك  المالك  كريغسمارينه المشغل كريغسمارينه (19 أغسطس 1941–4 مارس 1943)[1]  المشغلون الحاليون وسيط property غير متوفر. المشغلون السابقون وسيط property غير متوفر. التكلفة وسيط property غير متوفر. منظومة التعاريف الاَلية للسف�...

Newspaper in Indianapolis, Indiana, U.S. The Indianapolis StarTypeDaily newspaperFormatBroadsheetOwner(s)GannettEditorBro KriftFoundedJune 6, 1903; 120 years ago (1903-06-06)Headquarters130 South Meridian StreetIndianapolis, Indiana 46225 United StatesCirculation35,127 Weekday50,192 Sunday (as of Q3 2022)[1][2]ISSN1930-2533Websiteindystar.com The Indianapolis Star (also known as IndyStar) is a morning daily newspaper that began publishing on June 6, ...

Este artigo não cita fontes confiáveis. Ajude a inserir referências. Conteúdo não verificável pode ser removido.—Encontre fontes: ABW  • CAPES  • Google (N • L • A) (Março de 2011) O Brasenose College, Oxford é um dos colégios que constituem a Universidade de Oxford, no Reino Unido. Em 2006 contava com um pressuposto de 98 milhões de libras. História Fundado em 1509 pelo jurista Sir Richard Sutton, natural de Prestbury...

Sede do IHGRN A Coluna Capitolina, no pátio da sede do instituto O Instituto Histórico e Geográfico do Rio Grande do Norte (IHGRN) situa-se no bairro da Cidade Alta, em Natal, no estado brasileiro do Rio Grande do Norte. O IHGRN localiza-se ao lado da Catedral Antiga de Natal e do Palácio da Cultura (antiga sede do governo estadual), possuindo um rico acervo colonial histórico do estado. A História Colonial, especialmente a História da Capitania do Rio Grande, pode ser pesquisada pelo ...

Avenue in Manhattan, New York Template:Attached KML/Avenue C (Manhattan)KML is from Wikidata For other uses, see Avenue C (disambiguation). This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Avenue C Manhattan – news · newspapers · books · scholar · JSTOR (March 2019) (Learn how and when to remove this tem...

Pemilihan umum Bupati Donggala 20182013202327 Juni 2018[1]Kandidat   Calon Anita Bugiswaty Noerdin Kasman Lassa Vera Elena Laruni Partai PDIP Nasdem Golkar Pendamping Abdul Rahman Moh. Yasin Taufik M. Burhan Suara rakyat 39.736 53.042 41.845 Persentase 25,96% 34,65% 27,33%   Calon Idham Palaguma Partai Perseorangan Pendamping Muhammad Yasin M. Lataka Suara rakyat 18.471 Persentase 12,07% Bupati petahanaKasman Lassa Nasdem Bupati terpilih Kasman Lassa Nasdem Sunting...

Igneous rock with very large interlocked crystals Pegmatite with blue corundum crystals Pegmatite containing lepidolite, tourmaline, and quartz from the White Elephant Mine in the Black Hills, South Dakota Proterozoic pegmatite swarm in the headwall of the cirque of a small mountain glacier, northeastern Baffin Island, Nunavut A pegmatite is an igneous rock showing a very coarse texture, with large interlocking crystals usually greater in size than 1 cm (0.4 in) and sometimes greate...

Panmure House, the seat of the Earls of Panmure. Arms of Maule of Panmure: Per pale, argent and gules, a bordure charged with eight escallops, all countercharged. Earl of Panmure was a title in the Peerage of Scotland. It was created in 1646 for Sir Patrick Maule, a former Gentleman of the Bedchamber to James VI and loyal follower of Charles I. He was made Lord Brechin and Navar at the same time, also in the Peerage of Scotland. Both titles were forfeit by the attainder of the 4th Earl in 171...