OR2W3

OR2W3
Ідентифікатори
Символи OR2W3, OR2W3P, OR2W8P, OST718, olfactory receptor family 2 subfamily W member 3
Зовнішні ІД OMIM: 616729 MGI: 3030156 HomoloGene: 19876 GeneCards: OR2W3
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001001957
NM_207693
RefSeq (білок)
NP_001001957
NP_997576
Локус (UCSC) Хр. 1: 247.9 – 247.9 Mb Хр. 11: 58.55 – 58.56 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

OR2W3 (англ. Olfactory receptor family 2 subfamily W member 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 314 амінокислот, а молекулярна маса — 34 789[4].

Послідовність амінокислот
1020304050
MDGTNGSTQTHFILLGFSDRPHLERILFVVILIAYLLTLVGNTTIILVSR
LDPHLHTPMYFFLAHLSFLDLSFTTSSIPQLLYNLNGCDKTISYMGCAIQ
LFLFLGLGGVECLLLAVMAYDRCVAICKPLHYMVIMNPRLCRGLVSVTWG
CGVANSLAMSPVTLRLPRCGHHEVDHFLREMPALIRMACVSTVAIEGTVF
VLAVGVVLSPLVFILLSYSYIVRAVLQIRSASGRQKAFGTCGSHLTVVSL
FYGNIIYMYMQPGASSSQDQGMFLMLFYNIVTPLLNPLIYTLRNREVKGA
LGRLLLGKRELGKE

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Задіяний у такому біологічному процесі як поліморфізм. Локалізований у клітинній мембрані.

Література

  • Malnic B., Godfrey P.A., Buck L.B. (2004). The human olfactory receptor gene family. Proc. Natl. Acad. Sci. U.S.A. 101: 2584—2589. PMID 14983052 DOI:10.1073/pnas.0307882100
  • Malnic B., Godfrey P.A., Buck L.B. (2004). Proc. Natl. Acad. Sci. U.S.A. 101: 7205—7205. {{cite journal}}: Пропущений або порожній |title= (довідка)

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:15021 (англ.) . Процитовано 28 серпня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, Q7Z3T1 (англ.) . Архів оригіналу за 29 листопада 2016. Процитовано 28 серпня 2017.

Див. також


Read other articles:

Moch Salimꦩꦺꦴꦏ꦳꧈ ꦯꦭꦶꦩ꧀[[Bupati Rembang]] 19Masa jabatan2010 – 2015PresidenSusilo Bambang YudhoyonoJoko WidodoGubernurBibit WaluyoGanjar Pranowo[[Wakil Bupati Rembang|Wakil]]H. Abdul HafidzPendahuluHendarsonoPenggantiH. Abdul Hafidz Informasi pribadiLahir10 Mei 1970Rembang, Jawa TengahKebangsaanIndonesiaPartai politikPartai DemokratSuami/istriUmi Jazilah SalimAlma materSD Negeri Tasikagung I Rembang (1983)SMP Negeri 1 Rembang (1985)SMA Negeri 2 Rembang (198...

Dorothea Christina von AichelbergDorothea Christina von Aichelberg, detail from a family portraitBorn(1674-01-23)23 January 1674PlönDied22 June 1762(1762-06-22) (aged 88)ReinfeldBuried30 June 1762Ducal crypt in Plön CastleNoble familyvon AichelbergSpouse(s)Prince Christian Charles of Schleswig-Holstein-Sonderburg-Plön-NorburgFatherJohn Francis von AichelbergMotherAnna Sophia von Trautenburg gennant Beyern Dorothea Christina von Aichelberg (alternative spellings: Dorothee, Dorothy, Chr...

Saurashtraꢱꣃꢬꢵꢰ꣄ꢜ꣄ꢬJenis aksara Abugida BahasaSaurashtraPeriodeAbad ke-19 – sekarangArah penulisanKiri ke kananAksara terkaitSilsilahAksara Proto-Sinaitik[a]Aksara Fenisia[a]Aksara Aramaik[a]BrāhmīTamil-BrahmiPallavaGranthaSaurashtraAksara kerabatAksara MalayalamAksara TigalariDhives akuruISO 15924ISO 15924Saur, 344 , ​SaurashtraPengkodean UnicodeNama UnicodeSaurashtraRentang UnicodeU+A880–U+A8DF[a] Asal usul aksara Brahmik dalam bahasa Semit tidak...

Faroese football club (1940–2005) The topic of this article may not meet Wikipedia's notability guideline for sports and athletics. Please help to demonstrate the notability of the topic by citing reliable secondary sources that are independent of the topic and provide significant coverage of it beyond a mere trivial mention. If notability cannot be shown, the article is likely to be merged, redirected, or deleted.Find sources: SÍ Sumba – news · newspapers · bo...

Halftime show of the 2002 Super Bowl Super Bowl XXXVI halftime showPart ofSuper Bowl XXXVIDateFebruary 3, 2002LocationNew Orleans, LouisianaVenueLouisiana SuperdomeHeadlinerU2SponsorE-TradeProducerClear Channel EntertainmentSuper Bowl halftime show chronology XXXV(2001) XXXVI(2002) XXXVII(2003) The Super Bowl XXXVI Halftime Show, known through corporate sponsorship as the E-Trade Super Bowl XXXVI Halftime Show, was the halftime entertainment of Super Bowl XXXVI, which took place on February 3...

Los ricos no piden permiso Os Ricos Não Pedem Permissão (BR) Los ricos no piden permiso Informação geral Formato Telenovela Gênero Drama Duração 60 min (1 hora) Estado Concluída Criador(es) Adrián Suar País de origem  Argentina Idioma original espanhol Produção Diretor(es) Gustavo Luppi Rodolfo Antúnez Produtor(es) Adrián Suar Produtor(es) executivo(s) Leonardo Blanco Editor(es) Juan Pablo Lloret Juan Martín Riancho Roteirista(s) Marcos Carnevale Elenco Luciano Castro...

Species of bird Yucatan poorwill Conservation status Least Concern (IUCN 3.1)[1] Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Chordata Class: Aves Clade: Strisores Order: Caprimulgiformes Family: Caprimulgidae Genus: Nyctiphrynus Species: N. yucatanicus Binomial name Nyctiphrynus yucatanicus(Hartert, 1892) The Yucatan poorwill (Nyctiphrynus yucatanicus) is a species of nightjar in the family Caprimulgidae. It is found in the Yucatán Peninsula of Bel...

Artikel ini membutuhkan rujukan tambahan agar kualitasnya dapat dipastikan. Mohon bantu kami mengembangkan artikel ini dengan cara menambahkan rujukan ke sumber tepercaya. Pernyataan tak bersumber bisa saja dipertentangkan dan dihapus.Cari sumber: Universitas Negeri Jakarta – berita · surat kabar · buku · cendekiawan · JSTOR (Desember 2022) UNJ beralih ke halaman ini. Untuk halte bus Transjakarta, lihat UNJ (Transjakarta). Universitas Negeri JakartaLam...

Tourism around destinations associated with The Holocaust Main track of Auschwitz-Birkenau. Permanent exhibit at Auschwitz-Birkenau State Museum. Holocaust tourism is tourism to destinations connected with the extermination of Jews during the Holocaust in World War II, including visits to sites of Jewish martyrology such as former Nazi death camps and concentration camps turned into state museums.[1] It belongs to a category of the so-called 'roots tourism' usually across parts of Cen...

KategoriScriptPerancangGeorge RyanPenerbitInternational Typeface CorporationITC Kristen adalah rupa huruf tulisan tangan santai yang terdiri dari dua bobot dan dirancang oleh George Ryan untuk International Typeface Corporation (ITC). Huruf ini terilhami bentuk tulisan tangan pada menu restoran di Cambridge, Massachusetts.[1][2] Susunannya yang tidak seimbang memberikan kesan yang kekanak-kanakan pada jenis huruf ini.[3] Versi TrueType Kristen juga tersedia dalam paket...

Esta página cita fontes, mas que não cobrem todo o conteúdo. Ajude a inserir referências. Conteúdo não verificável pode ser removido.—Encontre fontes: ABW  • CAPES  • Google (N • L • A) (Dezembro de 2021) Torneio Internacional de Verão do Rio de Janeiro de 1973 Torneio Internacional de Verão Dados Participantes 4 Período 27 de janeiro de 1973 – 4 de fevereiro de 1973 Gol(o)s 6 Partidas 5 Média 1,2 gol(o)s por partida...

Mexican footballer (born 1990) For the Uruguayan footballer, see Jonathan dos Santos (Uruguayan footballer). In this Spanish name, the first or paternal surname is dos Santos and the second or maternal family name is Ramírez. Jonathan dos Santos Dos Santos with Mexico at the 2018 FIFA World CupPersonal informationFull name Jonathan dos Santos Ramírez[1]Date of birth (1990-04-26) 26 April 1990 (age 33)Place of birth Monterrey, Nuevo León, MexicoHeight 1.73 m (5...

US locomotive George W. Perry of the Cheshire Railroad Russia iron or Russian iron refers to a type of sheet iron produced in Russia during the 19th and early 20th century.[1][2] This iron sheeting had a smooth, glossy black surface coating, sometimes greenish-tinged, which did not flake upon bending and made the sheets highly resistant to rusting. As well as its corrosion resistance, the finish would also withstand high heat; these two properties accounted for most of its use...

TV tower in Turkey Endem TV TowerEndem TV TowerEndem TV Tower (Istanbul)LocationBüyükçekmece, Istanbul, TurkeyTower height257 m (843 ft)Coordinates41°01′34″N 28°37′15″E / 41.026111°N 28.620833°E / 41.026111; 28.620833Built1998-2008 Endem TV Tower is a TV tower in Büyükçekmece, Istanbul, Turkey. It was built between 1998 and 2008, and has a now-closed revolving restaurant 154 m (505 ft) above ground, as well as an observation deck a...

This is a list of the orders, medals and merit awards of Rwanda. Republic of Rwanda The Republic of Rwanda's honours system consists of orders and medals awarded for exemplary service to the nation.[1] Orders and Medals Acronym RDF Order of Honour OH National Liberation Medal LM Campaign Against Genocide Medal CGM Order of Bravery Medal OB Exemplary Performance Medal EPM Defence Superior Service Medal DSSM Joint Command Superior Medal JCM Land Forces Superior Service Medal SSM Air For...

2005 studio album by Slum VillageSlum VillageStudio album by Slum VillageReleasedOctober 25, 2005RecordedRJ Rice StudiosSouthfield, MichiganGenreHip hopLength47:48LabelBarak RecordsProducerBlack Milk, Young RJ, MoSSSlum Village chronology Detroit Deli (A Taste of Detroit)(2004) Slum Village(2005) Villa Manifesto EP(2009) Professional ratingsReview scoresSourceRatingOkayplayer link Slum Village is the fifth studio album by American hip hop group Slum Village, released on October 25, 20...

Halaman ini berisi artikel tentang suku Kellt. Untuk format berkas grafis, lihat PICT. Batu Ular Aberlemno, batu Pict Kelas I, memperlihatkan (atas ke bawah) ular, cakram ganda, Z-rod, cermin dan sisir. Pikt (bahasa Yunani Kuno: πυκτίς, pyktis)[1] atau Pict (bahasa Latin: pictus)[2][3] adalah sekumpulan manusia Akhir Zaman Besi dan Awal Abad Pertengahan yang menetap di daerah yang sekarang berupa Skotlandia timur dan utara.[4] Mereka sudah tercata...

Questa voce o sezione sull'argomento Competizioni calcistiche non è ancora formattata secondo gli standard. Commento: Si invita a seguire il modello di voce Contribuisci a migliorarla secondo le convenzioni di Wikipedia. Segui i suggerimenti del progetto di riferimento. Premijer liga BiH 2008-2009 Competizione Premijer liga BiH Sport Calcio Edizione 9ª Organizzatore N/FSBiH Date dal 2 agosto 2008al 23 maggio 2008 Luogo  Bosnia ed Erzegovina Partecipanti 16 Formula girone u...

This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) The topic of this article may not meet Wikipedia's general notability guideline. Please help to demonstrate the notability of the topic by citing reliable secondary sources that are independent of the topic and provide significant coverage of it beyond a mere trivial mention. If notability cannot be shown, the article is likely to be merged,...

Indian politician (1917–2006) Not to be confused with Satya Narayan Sinha. Satyendra Narayan Sinha19th Chief Minister of BiharIn office11 March 1989 – 6 December 1989Preceded byBhagwat Jha AzadSucceeded byJagannath MishraEducation Minister of Bihar[1]In office18 February 1961 – 1 October 1963In office1 October 1963 – 5 March 1967Chief MinisterBinodanand Jha, K.B.SahayPreceded byAcharya Badrinath VermaSucceeded byKarpoori ThakurPresident of International C...