OR9K2

OR9K2
Ідентифікатори
Символи OR9K2, OR12-2, olfactory receptor family 9 subfamily K member 2
Зовнішні ІД MGI: 3030659 HomoloGene: 121503 GeneCards: OR9K2
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001005243
NM_146677
RefSeq (білок)
NP_001005243
NP_666888
Локус (UCSC) Хр. 12: 55.13 – 55.13 Mb Хр. 10: 130 – 130 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

OR9K2 (англ. Olfactory receptor family 9 subfamily K member 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 335 амінокислот, а молекулярна маса — 37 746[4].

Послідовність амінокислот
1020304050
MLGSKPRVHLYILPCASQQVSTMGDRGTSNHSEMTDFILAGFRVRPELHI
LLFLLFLFVYAMILLGNVGMMTIIMTDPRLNTPMYFFLGNLSFIDLFYSS
VIEPKAMINFWSENKSISFAGCVAQLFLFALLIVTEGFLLAAMAYDRFIA
ICNPLLYSVQMSTRLCTQLVAGSYFCGCISSVIQTSMTFTLSFCASRAVD
HFYCDSRPLQRLSCSDLFIHRMISFSLSCIIILPTIIVIIVSYMYIVSTV
LKIHSTEGHKKAFSTCSSHLGVVSVLYGAVFFMYLTPDRFPELSKVASLC
YSLVTPMLNPLIYSLRNKDVQEALKKFLEKKNIIL

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Локалізований у клітинній мембрані, мембрані.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Malnic B., Godfrey P.A., Buck L.B. (2004). The human olfactory receptor gene family. Proc. Natl. Acad. Sci. U.S.A. 101: 2584—2589. PMID 14983052 DOI:10.1073/pnas.0307882100
  • Malnic B., Godfrey P.A., Buck L.B. (2004). Proc. Natl. Acad. Sci. U.S.A. 101: 7205—7205. {{cite journal}}: Пропущений або порожній |title= (довідка)

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:15339 (англ.) . Процитовано 11 вересня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, Q8NGE7 (англ.) . Архів оригіналу за 4 травня 2017. Процитовано 11 вересня 2017.

Див. також

Read other articles:

Ice skating discipline Synchronized skatingTeam Paradise at the 2015 Grand PrixHighest governing bodyInternational Skating UnionNicknamesprecision skating, synchroFirst Performed1956; 67 years ago (1956)CharacteristicsTeam members between 8 and 20 figure skaters including 4 alternates maximum 16 compete on the ice at once Mixed-sexMixedType Discipline of figure skating Team sport Winter sport Equipment Figure skates Venue Ice rink Figure skating rink PresenceOlympicNo&#...

هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (يوليو 2021) سليم أحمد حسن الموسى معلومات شخصية الميلاد 27 سبتمبر 1940 (العمر 83 سنة)جنين مواطنة أردني الحياة العملية المهنة كاتب اللغة الأم العربية  اللغات العربية بوابة �...

For a general overview of the Beach Boys' unreleased material, see The Beach Boys' unreleased and bootleg recordings. This article's factual accuracy is disputed. Relevant discussion may be found on the talk page. Please help to ensure that disputed statements are reliably sourced. (July 2020) (Learn how and when to remove this template message) Lists about the Beach BoysThe Beach Boys at a 1962 photoshoot. Discography Songs (Unreleased) Covers by the Beach Boys Covers of the Beach Boys Unrel...

Crestview Plaats in de Verenigde Staten Vlag van Verenigde Staten Locatie van Crestview in Florida Locatie van Florida in de VS Situering County Okaloosa County Type plaats City Staat Florida Coördinaten 30° 45′ NB, 86° 34′ WL Algemeen Oppervlakte 33,1 km² - land 33 km² - water 0,1 km² Inwoners (2006) 18.215 Hoogte 72 m Overig FIPS-code 15475 Portaal    Verenigde Staten Crestview is een plaats (city) in de Amerikaanse staat Florida, en valt bestuurlijk gezien onder...

Artikel ini perlu diwikifikasi agar memenuhi standar kualitas Wikipedia. Anda dapat memberikan bantuan berupa penambahan pranala dalam, atau dengan merapikan tata letak dari artikel ini. Untuk keterangan lebih lanjut, klik [tampil] di bagian kanan. Mengganti markah HTML dengan markah wiki bila dimungkinkan. Tambahkan pranala wiki. Bila dirasa perlu, buatlah pautan ke artikel wiki lainnya dengan cara menambahkan [[ dan ]] pada kata yang bersangkutan (lihat WP:LINK untuk keterangan lebih lanjut...

BahmanPa Sahli Tk. III Kasad bidang Wassus dan LHMasa jabatan17 Nopember 2021 – 21 Januari 2022PendahuluGregorius Henu BasworoDirdiklat PusteradMasa jabatan9 April 2020 – 17 Nopember 2021PendahuluTidak ada,Jabatan BaruPenggantiFarid MakrufKomandan Korem 173/Praja Vira BrajaMasa jabatan4 Desember 2017 – 9 April 2020PendahuluI Nyoman CantiasaPenggantiIwan Setiawan Informasi pribadiLahir21 Januari 1964 (umur 59)Alma materAkademi Militer (1988)Karier militerP...

Petar Čule (* 18. Februar 1898 in Kruševo bei Mostar, heute Bosnien-Herzegowina; † 29. Juli 1985 in Mostar) war ein römisch-katholischer Geistlicher und Bischof von Mostar-Duvno sowie damit zugleich Apostolischer Administrator des Bistums Trebinje-Mrkan. Leben Petar Čule besuchte ab 1909 acht Jahre lang das Gymnasium in Travnik. Die Matur erlangte Petar Čule im Jahre 1917. Das Theologiestudium absolvierte Čule von 1917 bis 1921 in Sarajevo. Am 20. Juni 1920 empfing er die Prieste...

2008 Major League Baseball All-Star Game 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 R H E National League 0 0 0 0 1 1 0 1 0 0 0 0 0 0 0 3 13 4 American League 0 0 0 0 0 0 2 1 0 0 0 0 0 0 1 4 14 1 DateJuly 15–16, 2008VenueYankee StadiumCityThe Bronx, New York CityManagersClint Hurdle (COL)Terry Francona (BOS)MVPJ. D. Drew (BOS)Attendance55,632Ceremonial first pitchYogi Berra, Whitey Ford, Goose Gossage and Reggie JacksonTelevisionFox (United States)MLB International (International)TV announcersJoe ...

قاعدة الوطح الصاروخية النوع قاعدة صواريخ الإحداثيات 24°12′49″N 44°42′07″E / 24.213691°N 44.701952°E / 24.213691; 44.701952 أنشئت في 2007 الملكية السعودية يديرها قوة الصواريخ الاستراتيجية الملكية السعودية تعديل مصدري - تعديل   قاعدة الوطح الصاروخية هي قاعدة صواريخ استراتيجية تقع في �...

international film school cologneifs internationale filmschule kölnTypePublic/PrivateEstablished2000LocationCologne, GermanyNicknameifsAffiliationsCILECTWebsitefilmschule.de The ifs internationale filmschule köln gmbh[1] (international film school cologne) is a privately funded film school in Cologne, Northrhine-Westphalia, Germany. The film school was founded by Filmstiftung NRW. In the German film school ranking of Focus (issue 22/2006), the international filmschool cologne—toge...

Bangladesh Film ArchiveFormation1978HeadquartersDhaka, BangladeshRegion served BangladeshOfficial language BengaliWebsitebfa.gov.bd Bangladesh Film Archive is an independent institution that is the national film archive of Bangladesh and preserves films, commercials and other visual medias produced in Bangladesh. It is located in Agargaon, Dhaka, Bangladesh.[1][2] History The archive was established in 1978 by the government of Bangladesh. In 1984 it was made an independent in...

For other people with the same name, see Abu Sayeed (disambiguation). Abu Sayeedআবু সাইয়ীদBorn1961 or 1962 (age 60–62)NationalityBangladeshiOccupation(s)Film director, screenwriter, television producerYears active1987–presentNotable workKittonkhola, Shangkhonad, Nirontor, Rupantor, Opekkha, Ekjon Kabir mrityuChildrenAnindo Sayeed Abu Sayeed (born 1962)[1] is a Bangladeshi film director, screenwriter, and television producer. As a filmmake...

For the Canadian TV series, see RapCity. For other uses, see Rap City (disambiguation). American TV series or program Rap CityThe outro frame, 2007Created byAlvin JonesKeith PaschellStephen G. HillCraig HenryJohn Dr. Teeth TuckerStarringChris Thomas (1989–1991)Hans Dobson (1989–1993)Prince DaJour (1991–1994)Joe Clair (1994–1999)Leslie Segar (1994–1999)Big Tigger (1998–2005)DJ Mad Linx (2005–2006)J-Nicks (2005–2006)Q-45 (2006–2008)Country of originUnited StatesProduction...

Indian television series Jeevan SaathiAlso known asJeevan Saathi — Humsafar Zindagi KeGenreDramaWritten byR M Joshi, Jayesh Patil, Shashi Mittal, Sumit Mittal, Zama Habib, Nikhilesh sharmaDirected bybhagwan yadav & Dharmesh ShahStarringSee belowOpening themeJeevan Saathi byCountry of originIndiaOriginal languageHindiNo. of seasons01No. of episodes310ProductionProducerParesh Rawal & Hemal ThakkarCamera setupMulti-cameraRunning timeApprox. 24 minutesProduction companyPlaytime Creation...

This article is about an album by a band of the same name. For other uses, see Mastodon (disambiguation). This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Mastodon album – news · newspapers · books · scholar · JSTOR (October 2021) (Learn how and when to remove this template message) 2008 box set by M...

Dominican footballer (born 1982) Miguel Lloyd Lloyd with Árabe Unido in 2015Personal informationFull name Miguel Starling Lloyd TroncosoDate of birth (1982-10-23) 23 October 1982 (age 41)Place of birth La Romana, Dominican RepublicHeight 1.80 m (5 ft 11 in)Position(s) GoalkeeperTeam informationCurrent team CibaoNumber 1Senior career*Years Team Apps (Gls)2003–2004 San Cristóbal 2005 Talleres 0 (0)2005–2006 Racing 0 (0)2006–2008 Barcelona Atlético 2008–2011 W Conn...

КілерAssassin Жанр екшн, трилер, кримінал, фантастикаУ головних ролях Номзамо Мбата, Домінік Перселл, Брюс Вілліс, Mustafa Shakird, Andy Allod, Hannah Quinlivand, Fernanda Andraded і Eugenia KuzminadТривалість 88 хв.Мова англійськаКраїна СШАРік 2023IMDb ID 14555174 «Кілер»[1] (англ. Assassin) — америк...

Indian academician Dev SwarupDev SwarupBorn10 JanuaryUttar PradeshOccupation(s)Educationist, Legal educator, Additional Secretary UGC, Vice ChancellorYears active1990 – presentWebsitewww.drdevswarup.com Dev Swarup is an Indian educational administrator. He is first founding vice-chancellor of Dr. Bhimrao Ambedkar Law University.[1][2] He has been also additional secretary (2019-2020) of University Grants Commission (India)[3] and joint secretary, UGC, New Delhi ...

República Soviética de ChinaZhōnghuá Sūwéi'āi Gònghēguó中華蘇維埃共和國(1931-1935)República Popular Soviética de ChinaZhōnghuá sūwéi'āi rénmín gònghéguó中華蘇維埃人民共和國(1935-1937) Estado no reconocido 1931-1937BanderaEscudo Lema: 全世界無產階級和被壓迫的民族聯合起來!(Quánshìjiè wúchǎnjiējí hé bèi yāpò de mínzú liánhé qǐlai!)«¡Proletarios y pueblos oprimidos del mundo, uníos!» Himno: 英特纳雄耐尔«La Inte...

Los Angeles Metro Rail station Highland Park Northbound A Line train approaching the platform in August 2023General informationLocation151 North Avenue 57Los Angeles, CaliforniaCoordinates34°06′40″N 118°11′33″W / 34.1112°N 118.1926°W / 34.1112; -118.1926Owned byLos Angeles County Metropolitan Transportation AuthorityPlatforms1 island platformTracks2ConnectionsLos Angeles Metro BusLADOT DASHConstructionStructure typeAt-gradeBicycle facilitiesRacks and l...