OR2G6

OR2G6
Ідентифікатори
Символи OR2G6, olfactory receptor family 2 subfamily G member 6
Зовнішні ІД MGI: 3031217 HomoloGene: 105344 GeneCards: OR2G6
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001013355
NM_207574
RefSeq (білок)
NP_001013373
NP_997457
Локус (UCSC) Хр. 1: 248.51 – 248.53 Mb Хр. 11: 49.41 – 49.42 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

OR2G6 (англ. Olfactory receptor family 2 subfamily G member 6) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 316 амінокислот, а молекулярна маса — 34 890[4].

Послідовність амінокислот
1020304050
MEETNNSSEKGFLLLGFSDQPQLERFLFAIILYFYVLSLLGNTALILVCC
LDSRLHTPMYFFLSNLSCVDICFTTSVAPQLLVTMNKKDKTMSYGGCVAQ
LYVAMGLGSSECILLAVMAYDRYAAVCRPLRYIAIMHPRFCASLAGGAWL
SGLITSLIQCSLTVQLPLCGHRTLDHIFCEVPVLIKLACVDTTFNEAELF
VASVVFLIVPVLLILVSYGFITQAVLRIKSAAGRQKAFGTCSSHLVVVII
FYGTIIFMYLQPANRRSKNQGKFVSLFYTIVTPLLNPIIYTLRNKDVKGA
LRTLILGSAAGQSHKD

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Задіяний у такому біологічному процесі як поліморфізм. Локалізований у клітинній мембрані.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:27019 (англ.) . Процитовано 28 серпня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, Q5TZ20 (англ.) . Архів оригіналу за 30 грудня 2016. Процитовано 28 серпня 2017.

Див. також


Read other articles:

ПравительствоХанты-Мансийского автономного округа - Югра Герб ХМАО Общая информация Страна  Россия Субъект  Ханты-Мансийский автономный округ — Югра Дата создания 1991 Предшественник Исполнительный комитет Совета народных депутатов Ханты-Мансийского автономного о

Artikel ini perlu diwikifikasi agar memenuhi standar kualitas Wikipedia. Anda dapat memberikan bantuan berupa penambahan pranala dalam, atau dengan merapikan tata letak dari artikel ini. Untuk keterangan lebih lanjut, klik [tampil] di bagian kanan. Mengganti markah HTML dengan markah wiki bila dimungkinkan. Tambahkan pranala wiki. Bila dirasa perlu, buatlah pautan ke artikel wiki lainnya dengan cara menambahkan [[ dan ]] pada kata yang bersangkutan (lihat WP:LINK untuk keterangan lebih lanjut...

Airlines that are from Saudi Arabia. This is a list of airlines currently operating in Saudi Arabia. Scheduled airlines Airline Image IATA ICAO Callsign Commencedoperations Flyadeal F3 FAD ADEAL 2017 Flynas XY KNE NAS EXPRESS 2007 Riyadh Air RX RIX RIYADH AIR 2025 Saudia SV SVA SAUDIA 1945 Nesma Airlines NE NSS NESMA 2010 Charter airlines Airline Image IATA ICAO Callsign Commencedoperations Al Anwa Aviation 2013 Dallah Avco 1975 Mid East Jet XAH 1990 Sky Prime Aviation UY SPD SKYPRIME 2016 Ca...

Myatt's Fields ParkMyatt's Fields Park in winterLocation within central LondonTypePublic parkLocationLondon, EnglandCoordinates51°28′24″N 0°06′12″W / 51.473333°N 0.103333°W / 51.473333; -0.103333StatusOpen year roundWebsitewww.myattsfieldspark.info Myatt's Fields Park is a 14-acre Victorian park in Camberwell in the London Borough of Lambeth in South London, England, 2.9 miles south-east of Charing Cross. History The majority of the area of Myatt's Fields b...

هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (سبتمبر 2018) زولتان ماغيار زولتان ماغيار سنة 1967 معلومات شخصية الميلاد 13 ديسمبر 1953 (العمر 69 سنة)بودابست، المجر الطول 165 سم الجنسية  المجر الوزن 60 كغ الحياة العملية الفرق

1942–1945 Japanese military rule over Singapore For the Shinto shrine, see Syonan Jinja. Syonan Island昭南島 Shōnantō1942–1945 Flag of the Empire of Japan Imperial Seal Anthem: Kimigayo(English: His Imperial Majesty's Reign)[1][2]The Empire of Japan at its peak in 1942:    Territory (1870–1895)   Acquisitions (1895–1930)   Acquisitions (1930–1942)StatusMilitary occupationOfficial language and national languageJapaneseCommon lan...

إن الحياة البرية في قارة إفريقيا تتميز بتنوع حيواني مذهل، وجميع الحيوانات تعيش في أنماط بيئية محيطة بالبحر والجزر والتي تجعل منها مكانا للتكاثر، واكتشاف أنواع جديدة، وعلى مر السنين كانت قارة أفريقيا مركزا للتنوع الحيواني، ويوجد النصف الأكبر من الاختلافات المتنوعة من الحي

Complete Crumb ComicsCover to Volume 3 of The Complete Crumb Comics.Publication informationPublisherFantagraphics BooksScheduleirregularGenreUnderground comixPublication date1987 – 2005No. of issues17Creative teamCreated byRobert CrumbArtist(s)Robert CrumbEditor(s)Gary Groth, Robert Fiore The Complete Crumb Comics is a series of collections from Fantagraphics Books which was intended to reproduce the entire body of American cartoonist and comic book artist/writer Robert Crumb's comics ...

1971 live album by Bill CosbyWhen I Was a KidLive album by Bill CosbyReleasedFebruary 1971GenreStand-up comedyLabelMCA RecordsBill Cosby chronology Live: Madison Square Garden Center(1970) When I Was a Kid(1971) For Adults Only(1971) Professional ratingsReview scoresSourceRatingAllmusic [1] When I Was a Kid (1971) is the 12th comedy album by Bill Cosby, recorded at the Westbury Music Fair (later renamed Theatre at Westbury). The cover is an early appearance of Fat Albert and t...

2. Armee País  Alemanha Corporação Heer Unidade Exército Denominação AOK 2 Criação 26 de agosto de 1939 Extinção 7 de abril de 1945 História Guerras/batalhas Segunda Guerra Mundial O 2º Exército (em alemão 2. Armee) foi formado em 26 de agosto de 1939 a partir do Heeresgruppenkommando 1. Foi redesignado Heeresgruppe Nord, em 2 de Setembro de 1939.[1][2] O 2º Exército foi reformado em 20 de Outubro de 1939. O pessoal também era conhecido como Armeegruppe Weichs sendo coma...

Simón-Bolívar-Büste Die Büste von Simón-Bolívar steht in Bremen-Horn-Lehe. Sie wurde 2012 auf dem Gelände der Universität Bremen aufgestellt und wird in der Liste der Denkmale und Standbilder der Stadt Bremen geführt. Inhaltsverzeichnis 1 Denkmal und Büste 2 Simón Bolívar 3 Literatur 4 Einzelnachweise Denkmal und Büste Das Denkmal aus Marmor für Simón Bolívar wurde 1933 von der Republik Venezuela anlässlich des 150. Geburtstages des Befreiers an Bremen gestiftet. Initiator de...

Ini adalah nama India; nama Sandhu merupakan patronimik, bukan nama keluarga, dan tokoh ini dipanggil menggunakan nama depannya, Nandish. Ini adalah nama India; nama Singh merupakan patronimik, bukan nama keluarga, dan tokoh ini dipanggil menggunakan nama depannya, Nandish. Nandish SinghNandish SandhuNandish SinghLahir25 Desember 1981 (umur 41)[1][2]Bharatpur, Rajasthan, IndiaPekerjaanModel, AktorTahun aktif1988 – presentDikenal atasMemerankan Veer Singh Bundela di...

42°41′43″N 23°19′47″E / 42.69528°N 23.32972°E / 42.69528; 23.32972The Central Military Club The Central Military Club (Bulgarian: Централен военен клуб, Tsentralen voenen klub) is a multi-purpose monument of culture building in the centre of Sofia, the capital of Bulgaria, located on Tsar Osvoboditel Boulevard and Georgi Rakovski Street. It serves the Bulgarian Army and is administered by the Executive Agency of Military Clubs and Informa...

This article contains too many or overly lengthy quotations. Please help summarize the quotations. Consider transferring direct quotations to Wikiquote or excerpts to Wikisource. (June 2013) A bunyip depicted in 1890 Bunyip aristocracy is an Australian term satirising attempts by William Wentworth to establish a system of titles in the colony of New South Wales. It was coined in 1853 by Daniel Deniehy in what came to be known as the Bunyip Aristocracy speech which he delivered in the Victoria...

Classification system for Earth's landforms based on the work on N. M. Fenneman Physiographic regions are a means of defining Earth's landforms into distinct, mutually exclusive areas, independent of political boundaries. It is based upon the classic three-tiered approach by Nevin M. Fenneman in 1916, that separates landforms into physiographic divisions, physiographic provinces, and physiographic sections.[1] The classification mechanism has become a popular geographical tool in the ...

Maremagnum Shopping & dinning at the marina. Vista del Maremagnum en el Puerto ViejoUbicación  Barcelona Cataluña EspañaCoordenadas 41°22′31″N 2°10′58″E / 41.37517, 2.18274Dirección Moll d'Espanya, 5Apertura 7 de mayo de 1995Propietario Corio Real Estate España, SLArquitectos Helio Piñón, Albert Viaplana, Rafael CollSuperficie total 22.000 m² (SBA)Estacionamiento 840 plazasN.º de plantas 3http://www.maremagnum.es/[editar datos en Wiki...

Papiro 9Manoscritto del Nuovo TestamentoNomeP. Oxyrhyncus 402 Simbolo p {\displaystyle {\mathfrak {p}}} 9 TestoPrima lettera di Giovanni 10; 11 DatazioneIII secolo Scritturagreco ConservazioneHoughton Library Tipo testualealessandrino CategoriaI Il Papiro 9 ( p {\displaystyle {\mathfrak {p}}} 9) è uno dei più antichi manoscritti esistenti del Nuovo Testamento, datato paleograficamente agli inizi del III secolo.[1] È scritto in greco. Indice 1 Contenuto del papiro 2 Note 3 Bibliogra...

2018 studio album by TamiaPassion Like FireStudio album by TamiaReleasedSeptember 7, 2018[1]Length44:29Label Plus One E1 Music ProducerDaniel BryantShep CrawfordRyan HawkenKing BNJMNLil' RonnieSalaam RemiJulio Reyes CopelloMajor SevenTamia chronology Love Life(2015) Passion Like Fire(2018) Singles from Passion Like Fire Leave It Smokin'Released: April 27, 2018 Today I DoReleased: July 24, 2018 It's YoursReleased: October 16, 2018 Passion Like Fire is the seventh studio album b...

Location of Okaloosa County in Florida This is a list of the National Register of Historic Places listings in Okaloosa County, Florida. This is intended to be a complete list of the properties and districts on the National Register of Historic Places in Okaloosa County, Florida, United States. The locations of National Register properties and districts for which the latitude and longitude coordinates are included below, may be seen in a map.[1] There are 9 properties and districts li...

San Cristóbal Ciudad Desde arriba hacia la izquierda: Montañas de San Cristóbal, Zona comercial, Fuente, Torre Pepita, Castillo de la fantasía, Centro comercial, Atardecer y Obelisco. BanderaEscudo Lema: La Ciudad de la Cordialidad. San CristóbalLocalización de San Cristóbal en Venezuela San CristóbalLocalización de San Cristóbal en TáchiraCoordenadas 7°46′05″N 72°13′56″O / 7.7681722222222, -72.232241666667Entidad Ciudad • País Venezuela Venezuela&...