OR8B8

OR8B8
Ідентифікатори
Символи OR8B8, TPCR85, olfactory receptor family 8 subfamily B member 8
Зовнішні ІД MGI: 2177528 HomoloGene: 56568 GeneCards: OR8B8
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
26493
258310
Ensembl
ENSG00000197125
ENSMUSG00000066748
UniProt
Q15620
Q60882
RefSeq (мРНК)
NM_012378
NM_146313
RefSeq (білок)
NP_036510
NP_666425
Локус (UCSC) Хр. 11: 124.44 – 124.45 Mb Хр. 9: 37.81 – 37.81 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

OR8B8 (англ. Olfactory receptor family 8 subfamily B member 8) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 311 амінокислот, а молекулярна маса — 34 482[4].

Послідовність амінокислот
1020304050
MAAENSSFVTQFILAGLTDQPGVQIPLFFLFLGFYVVTVVGNLGLITLIR
LNSHLHTPMYFFLYNLSFIDFCYSSVITPKMLMSFVLKKNSISYAGCMTQ
LFFFLFFVVSESFILSAMAYDRYVAICNPLLYMVTMSPQVCFLLLLGVYG
MGFAGAMAHTACMMGVTFCANNLVNHYMCDILPLLECACTSTYVNELVVF
VVVGIDIGVPTVTIFISYALILSSIFHIDSTEGRSKAFSTCSSHIIAVSL
FFGSGAFMYLKPFSLLAMNQGKVSSLFYTTVVPMLNPLIYSLRNKDVKVA
LKKILNKNAFS

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Локалізований у клітинній мембрані, мембрані.

Література

  • Gaudin J.-C., Breuils L., Haertle T. (2001). New GPCRs from a human lingual cDNA library. Chem. Senses. 26: 1157—1166. PMID 11705801 doi:10.1093/chemse/26.9.1157
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 doi:10.1101/gr.2596504
  • Vanderhaeghen P., Schurmans S., Vassart G., Parmentier M. (1997). Specific repertoire of olfactory receptor genes in the male germ cells of several mammalian species. Genomics. 39: 239—246. PMID 9119360 doi:10.1006/geno.1996.4490

Примітки

  1. ↑ Human PubMed Reference:.
  2. ↑ Mouse PubMed Reference:.
  3. ↑ HUGO Gene Nomenclature Commitee, HGNC:8477 (англ.) . Процитовано 8 вересня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. ↑ UniProt, Q15620 (англ.) . Архів оригіналу за 27 вересня 2017. Процитовано 8 вересня 2017.

Див. також

Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

Read other articles:

MySQL Workbench

MySQL WorkbenchTangkapan layar The Home ScreenTipeperangkat lunak bebas Versi stabil 8.0.36 (20 Desember 2023) LisensiGNU General Public License or proprietary EULAKarakteristik teknisSistem operasiCross-platformPlatformWindows Bahasa pemrogramanC#, C++ dan Objective-C Format kodeDaftarMySQL Workbench model archive (en) Format berkasDaftarMySQL Workbench model archive (en) Informasi pengembangPengembangOracle CorporationSumber kode Kode sumberPranala Debianmysql-workbench Arch Linuxmysql-work...

 

Labuhan Haji, Lombok Timur

Untuk tempat lain yang bernama sama, lihat Labuhan Haji. Labuhan HajiKecamatanNegara IndonesiaProvinsiNusa Tenggara BaratKabupatenLombok TimurPemerintahan • Camat-Populasi • Total51,603 jiwa jiwaKode Kemendagri52.03.17 Kode BPS5203071 Luas49,57 km²Desa/kelurahan-3 Labuhan Haji adalah sebuah kecamatan di kabupaten Lombok Timur, Nusa Tenggara Barat, Indonesia. Sejarah Pemandangan laut di Labuhan Haji pada tahun 1925 Berdasarkan sejarah daerah ini dinamakan Labuhan ...

 

2008 en France

Chronologies Logo de Bienvenue chez les Ch'tis film culte sorti en 2008.Données clés 2005 2006 2007  2008  2009 2010 2011Décennies :1970 1980 1990  2000  2010 2020 2030Siècles :XIXe XXe  XXIe  XXIIe XXIIIeMillénaires :Ier IIe  IIIe  Chronologies géographiques Afrique Afrique du Sud, Algérie, Angola, Bénin, Botswana, Burkina Faso, Burundi, Cameroun, Cap-Vert, République centrafricaine, Comores, République du Congo, République d...

The Stolen Jools

The Stolen JoolsGeorge E. Stone dalam film The Stolen JoolsSutradaraWilliam C. McGannProduserPat CaseyDitulis olehEdwin J. Burke (uncredited)Percy Heath (uncredited)PemeranBuster KeatonEdward G. RobinsonJoan CrawfordFay WrayGary CooperDistributorParamount PicturesTanggal rilis 4 April 1931 (1931-04-04) Durasi20 menitNegaraAmerika SerikatBahasaInggris The Stolen Jools adalah sebuah film pendek komedi Pre-Code Amerika 1931 yang diproduksi oleh Masquers Club dari Hollywood, yang menampilkan...

 

Mean free path

Average distance travelled by a moving particle between impacts with other particles In physics, mean free path is the average distance over which a moving particle (such as an atom, a molecule, or a photon) travels before substantially changing its direction or energy (or, in a specific context, other properties), typically as a result of one or more successive collisions with other particles. Scattering theory Slab of target Imagine a beam of particles being shot through a target, and consi...

 

A Beautiful Noise

2020 song by Alicia Keys and Brandi Carlile For the Neil Diamond musical, see A Beautiful Noise (musical). A Beautiful NoiseSingle by Alicia Keys and Brandi CarlileReleasedOctober 29, 2020 (2020-10-29)Genre R&B soul Length3:19LabelRCASongwriter(s)Alicia KeysBrandi CarlileBrandy ClarkHailey WhittersHillary LindseyLinda PerryLori McKennaRuby AmanfuProducer(s)Alicia KeysBrandi CarlileAlicia Keys singles chronology Love Looks Better (2020) A Beautiful Noise (2020) Wasted En...

Red Scare (podcast)

American culture and comedy podcast PodcastRed ScarePresentationHosted byAnna KhachiyanDasha NekrasovaGenreCultural criticismhumorpoliticsLanguageEnglishLength60–120 minutesCountry of originUnited StatesProductionProductionMeg Murnane (Mar–Oct 2018), subsequently self-producedTheme music composed byTrevor HornMartin KierszenbaumOpening themeAll the Things She Said by t.A.T.uAudio formatMP3No. of episodes375PublicationOriginal releaseMarch 29, 2018; 6 years ago (2018-03-2...

 

Unione Sportiva Pistoiese 1921 2013-2014

Questa voce o sezione sull'argomento stagioni delle società calcistiche italiane non cita le fonti necessarie o quelle presenti sono insufficienti. Puoi migliorare questa voce aggiungendo citazioni da fonti attendibili secondo le linee guida sull'uso delle fonti. Segui i suggerimenti del progetto di riferimento. Questa voce sull'argomento stagioni delle società calcistiche italiane è solo un abbozzo. Contribuisci a migliorarla secondo le convenzioni di Wikipedia. Segui i suggeri...

 

Greece–Japan relations

This article's lead section may be too short to adequately summarize the key points. Please consider expanding the lead to provide an accessible overview of all important aspects of the article. (January 2022) Bilateral relationsGreco-Japanese relations Greece Japan Greco-Japanese relations are foreign relations between Greece and Japan. Diplomatic relations Greece and Japan established diplomatic relations in 1899. There has been a Greek Embassy in Tokyo since 1960, and a Japanese Embassy in...

Sons of Anarchy season 1

First season of TV series Sons of Anarchy Season of television series Sons of AnarchySeason 1DVD coverStarring Charlie Hunnam Katey Sagal Mark Boone Junior Kim Coates Tommy Flanagan Johnny Lewis Maggie Siff Ron Perlman No. of episodes13ReleaseOriginal networkFXOriginal releaseSeptember 3 (2008-09-03) –November 26, 2008 (2008-11-26)Season chronologyNext →Season 2 List of episodes The first season of the American television drama series Sons of Anarchy premiered on Sept...

 

Acide γ-aminobutyrique

Pour les articles homonymes, voir GABA. Acide γ-aminobutyrique Structure du GABA. Identification Nom UICPA acide 4-aminobutanoïque No CAS 56-12-2 No ECHA 100.000.235 No CE 200-258-6 PubChem 119 FEMA 4288 Propriétés chimiques Formule C4H9NO2  [Isomères] Masse molaire[1] 103,119 8 ± 0,004 6 g/mol C 46,59 %, H 8,8 %, N 13,58 %, O 31,03 %, pKa 4,0459 Propriétés physiques T° fusion 203...

 

ميخائيل فرونزه

ميخائيل فرونزМихаил Фрунзе (بالروسية: Михаил Фрунзе)‏    وزير الدفاع في المنصب15 يناير 1925 – 31 أكتوبر 1925 ليون تروتسكي كليمنت فوروشيلوف مرشح لعضوية المكتب السياسي في المنصب2 يونيو 1924 – 31 أكتوبر 1925 معلومات شخصية الميلاد 21 يناير 1885 [1][2]  بيشكك  الوفاة 31 أكتوبر...

2002–03 Cypriot Third Division

Football league seasonCypriot Third DivisionSeason2002–03ChampionsPAEEK FC(2nd title)PromotedPAEEK FCAkritasOmonia Ar.RelegatedOthellosAchyronasEliaMatches played182Goals scored644 (3.54 per match)← 2001–02 2003–04 → The 2002–03 Cypriot Third Division was the 32nd season of the Cypriot third-level football league. PAEEK FC won their 2nd title. Format Fourteen teams participated in the 2002–03 Cypriot Third Division. All teams played against each other twice, once at their h...

 

Élection à la direction du Parti conservateur britannique de 1989

Cet article est une ébauche concernant une élection ou un référendum et le Royaume-Uni. Vous pouvez partager vos connaissances en l’améliorant (comment ?) selon les recommandations des projets correspondants. 1975 1990 Élection à la direction du Parti conservateur de 1989 5 décembre 1989 Margaret Thatcher – Parti conservateur Voix 314 84,0 %  Anthony Meyer – Parti conservateur Voix 33 8,8 %  Chef du Parti conservateur Sortant Élu Margaret...

 

December 1922

Month of 1922 1922 January February March April May June July August September October November December << December 1922 >> Su Mo Tu We Th Fr Sa 01 02 03 04 05 06 07 08 09 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31   December 30, 1922: The Union of Soviet Socialist Republics is created as the first Communist nation, with the Russian Soviet Federative Socialist Republic being joined by the Communist republics established in Ukraine, Belarus, Armenia, Az...

Confucianism

Chinese ethical and philosophical system Part of a series onConfucianism Early history Spring and Autumn period Confucius Warring States period Mencius Xunzi Western Han Dong Zhongshu Gongsun Hong Fundamental concepts Tian Ganying Zhengming Xiao Sangang Wuchang Li Ren Xin Yi Schools Neo-Confucianism Han Learning Taigu school Lingnan Confucianism New Confucianism Progressive Confucianism Hermeneutic schools Old Text New Text Confucianism by country Korea Japan Indonesia United States Confucian...

 

Sanatsujatiya

Sanatasugata mengajarkan Atma vidya kepada Raja Dṛetarāṣṭra Sanatsujatiya (Dewanagari: सानत्सुजातिय; ,IAST: Sānatsujātiya, सानत्सुजातिय) mengacu pada satu bagian dalam Mahābhārata, sebuah wiracarita Hindu. Itu muncul dalam Udyogaparwa dan terdiri dari lima bab (adhyāya 41–46).[1] Sanatsujatiya berisi ajaran tentang keabadian dan brahmacarya.[2] Salah satu alasan pentingnya Sanatsujatiya adalah karena diula...

 

Ma Barker

Not to be confused with the character of the animated television series Go, Dog. Go!. This article includes a list of references, related reading, or external links, but its sources remain unclear because it lacks inline citations. Please help improve this article by introducing more precise citations. (January 2022) (Learn how and when to remove this message) American mother of several criminals and Barker Gang leader (1873–1935) Kate BarkerBarker circa 1932BornArizona Donnie Clark(1873-10...

Rapid City Fruit Company

United States historic placeRapid City Fruit CompanyU.S. National Register of Historic Places Rapid City Fruit Company building in 2017Show map of South DakotaShow map of the United StatesLocation320 7th St., Rapid City, South DakotaCoordinates44°05′30″N 103°13′39″W / 44.09167°N 103.22750°W / 44.09167; -103.22750 (Rapid City Fruit Company)Arealess than one acreBuilt1920 (1920)Built byC. A. Nesbit, Claude E. GrayArchitectural styleEarly 20t...

 

United States District Court for the Northern District of Georgia

United States federal district court in Georgia (U.S. state) United States District Court for the Northern District of Georgia(N.D. Ga.)LocationRichard B. Russell Federal Building(Atlanta)More locationsGainesvilleNewnanRomeAppeals toEleventh CircuitEstablishedAugust 11, 1848Judges11Chief JudgeTimothy BattenOfficers of the courtU.S. AttorneyRyan K. BuchananU.S. MarshalThomas E. Browngand.uscourts.gov The United States District Court for the Northern District of Georgia (in ...