OR2T11

OR2T11
Ідентифікатори
Символи OR2T11, OR2T11Q, olfactory receptor family 2 subfamily T member 11 (gene/pseudogene), olfactory receptor family 2 subfamily T member 11
Зовнішні ІД HomoloGene: 84585 GeneCards: OR2T11
Шаблон експресії




Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001001964
н/д
RefSeq (білок)
NP_001001964
н/д
Локус (UCSC) Хр. 1: 248.62 – 248.64 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей

OR2T11 (англ. Olfactory receptor family 2 subfamily T member 11 (gene/pseudogene)) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [2] Довжина поліпептидного ланцюга білка становить 316 амінокислот, а молекулярна маса — 34 797[3].

Послідовність амінокислот
1020304050
MTNTSSSDFTLLGLLVNSEAAGIVFTVILAVFLGAVTANLVMIFLIQVDS
RLHTPMYFLLSQLSIMDTLFICTTVPKLLADMVSKEKIISFVACGIQIFL
YLTMIGSEFFLLGLMAYDCYVAVCNPLRYPVLMNRKKCLLLAAGAWFGGS
LDGFLLTPITMNVPYCGSRSINHFFCEIPAVLKLACADTSLYETLMYICC
VLMLLIPISIISTSYSLILLTIHRMPSAEGRKKAFTTCSSHLTVVSIFYG
AAFYTYVLPQSFHTPEQDKVVSAFYTIVTPMLNPLIYSLRNKDVIGAFKK
VFACCSSAQKVATSDA

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Задіяний у такому біологічному процесі як поліморфізм. Локалізований у клітинній мембрані.

Література

  • Malnic B., Godfrey P.A., Buck L.B. (2004). The human olfactory receptor gene family. Proc. Natl. Acad. Sci. U.S.A. 101: 2584—2589. PMID 14983052 DOI:10.1073/pnas.0307882100
  • Malnic B., Godfrey P.A., Buck L.B. (2004). Proc. Natl. Acad. Sci. U.S.A. 101: 7205—7205. {{cite journal}}: Пропущений або порожній |title= (довідка)

Примітки

  1. Human PubMed Reference:.
  2. HUGO Gene Nomenclature Commitee, HGNC:19574 (англ.) . Процитовано 28 серпня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  3. UniProt, Q8NH01 (англ.) . Архів оригіналу за 29 грудня 2016. Процитовано 28 серпня 2017.

Див. також


Read other articles:

Allah Peliharakan Sultanلله فليهاراكن سلطنLagu kebangsaan  BruneiPenulis lirikPengiran Haji Mohamed Yusuf bin Pengiran Abdul Rahim (Yura Halim)[1], 1947KomponisHaji Awang Besar bin Sagap, 1947Penggunaan1951Sampel audioAllah Peliharakan Sultanberkasbantuan Allah Peliharakan Sultan merupakan lagu kebangsaan Brunei Darussalam. Lagu ini ditulis oleh Pangeran Haji Mohamed Yusuf bin Abdul Rahim dan digubah oleh Awang Haji Besar bin Sagap pada tahun 1947. Pada tahun 1951...

The history of the Baháʼí Faith in Africa dates back to the lifetimes of the three individual heads of the religion, Baháʼu'lláh, ʻAbdu'l-Bahá, and Shoghi Effendi, each of who was in Africa at least once. The Association of Religion Data Archives (relying on World Christian Encyclopedia) lists many larger and smaller populations in Africa[1] with Kenya, the Democratic Republic of the Congo, South Africa and Zambia among the top ten numerical populations of Baháʼís in the wo...

Kloster bzw. Schloss Edelstetten (von der Straße nach Neuburg aus fotografiert) Stiftsgebäude und Kirche St. Johannes Baptist und Johannes Evangelist von Westen Das Kloster Edelstetten ist ein ehemaliges Kanonissenstift in Edelstetten (Gemeinde Neuburg an der Kammel) in Bayern in der Diözese Augsburg. 1804/1805 erwarb Fürst Nikolaus II. Esterházy de Galantha die aufgelöste Klosteranlage und wandelte sie in das Schloss Edelstetten um. Das ehemalige Kloster ist einer der herausragenden Ba...

Artikel ini tidak memiliki referensi atau sumber tepercaya sehingga isinya tidak bisa dipastikan. Tolong bantu perbaiki artikel ini dengan menambahkan referensi yang layak. Tulisan tanpa sumber dapat dipertanyakan dan dihapus sewaktu-waktu.Cari sumber: Ali Suavi – berita · surat kabar · buku · cendekiawan · JSTOR Ali Suavi (1838-1878) ialah seorang pemberontak dan penulis. Ia menulis di surat kabar Muhbir pada tahun 1866, melarikan diri ke Eropa pada t...

Surviv.ioInformasi produksiPengembang Justin Kim Nick Clark Kongregate Data permainanPlatform Browser Android iOS macOS Microsoft Windows GenreBattle royaleModeMultiplayer PerilisanTanggal rilisBrowsersOktober 11, 2017iOSOktober 4, 2018AndroidNovember 5, 2018macOS, WindowsSeptember 24, 2020Portal permainan videoL • B • PWBantuan penggunaan templat ini Surviv.io merupakan salah satu permainan battle royale 2 dimensi, online multipemain berbasis browser yang dibuat dan dikembangka...

العلاقات الإيطالية الفرنسية   فرنسا   إيطاليا تعديل مصدري - تعديل   تشير العلاقات الإيطالية الفرنسية إلى العلاقات الدولية بين الجمهوريتين الفرنسية والإيطالية، والتي تتجسد على أصعدة عدّة، كالدبلوماسي والسياسي والعسكري والاقتصادي والثقافي بين فرنسا وإيطاليا ...

Fomento de Construcciones y Contratas, S.A.JenisSociedad AnónimaKode emitenBMAD: FCCIndustriKonstruksi, teknik sipilDidirikan1900KantorpusatBarcelona, SpanyolTokohkunciCarlos Jarque (Chairman dan CEO)Pendapatan€11,152 milyar (2012)[1]Laba operasi€753 juta (2012)[1]Laba bersih€(1.028) juta (2012)[1]Karyawan92.290 (rerata, 2010)[2]AnakusahaFCC EnvironmentSitus webwww.fcc.es Fomento de Construcciones y Contratas, S.A. (pengucapan bahasa Spanyol: [...

بنك الجيناتالمحتوياتالوصفتسلسل النوكليوتيدات لأكثر من 300000 كائن حي مع دعم الشرح الببليوغرافي والبيولوجي.نوع البياناتقالب:تسلسل النيوكليوتيداتالكائناتالكلالعناوينمركز الأبحاثNCBIالاستشهاد الأولى21071399تاريخ الإطلاققالب:تاريخ البدء والعمرالوصولصيغة الملف لغة الترميز ال�...

Per Ciljan Skjelbred Informasi pribadiNama lengkap Per Ciljan SkjelbredTanggal lahir 16 Juni 1987 (umur 36)Tempat lahir Trondheim, NorwegiaTinggi 175 m (574 ft 2 in)Posisi bermain GelandangInformasi klubKlub saat ini Hertha BSCNomor 3Karier junior Trygg/LadeKarier senior*Tahun Tim Tampil (Gol)2004–2011 Rosenborg 155 (9)2011–2014 Hamburger SV 26 (0)2013–2014 → Hertha BSC (pinjaman) 28 (2)2014– Hertha BSC 81 (0)Tim nasional‡2007–2017 Norwegia 43 (1) * Penampila...

This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) Some of this article's listed sources may not be reliable. Please help this article by looking for better, more reliable sources. Unreliable citations may be challenged or deleted. (September 2022) (Learn how and when to remove this template message) This article possibly contains original research. Please improve it by verifying the claims ...

Isabella of VillehardouinBorn1260/1263Died23 January 1312Spouse Philip of Sicily ​ ​(m. 1271; died 1277)​ Florent of Hainaut ​ ​(m. 1289; died 1297)​ Philip of Savoy, Lord of Piedmont ​ ​(m. 1301)​ IssueMatilda of HainautHouseVillehardouinFatherWilliam II of VillehardouinMotherAnna Komnene Doukaina Isabella of Villehardouin (1260/1263 – 23 January 1312) was reig...

Species of moth Anuga multiplicans Scientific classification Kingdom: Animalia Phylum: Arthropoda Class: Insecta Order: Lepidoptera Family: Noctuidae Genus: Anuga Species: A. multiplicans Binomial name Anuga multiplicansWalker, 1858 Anuga multiplicans is a moth of the family Noctuidae first described by Francis Walker in 1858.[1] It is found in India, Sri Lanka,[2] Hong Kong, Korea, Taiwan, Philippines and Borneo. Forewings darker and with subtornal orange spot. Discal sp...

Protocol for real-time Internet chat and messaging IRC redirects here. For other uses, see IRC (disambiguation). For Wikipedia-related IRC channels, see Wikipedia:IRC. Internet Relay ChatCommunication protocolAbbreviationIRCPurposeInstant messagingDeveloper(s)Jarkko OikarinenIntroductionAugust 1988; 35 years ago (1988-08)InfluencedNot yet supersededIRCv3 (standards process working group)OSI layerApplication layerPort(s)6667, 6697RFC(s)RFC 1459 Internet protocol suite Ap...

Hospital in Cornwall, EnglandWest Cornwall HospitalRoyal Cornwall Hospitals NHS TrustWest Cornwall HospitalShown in CornwallGeographyLocationPenzance, Cornwall, EnglandCoordinates50°07′19″N 5°32′24″W / 50.122°N 5.540°W / 50.122; -5.540OrganisationCare systemNational Health ServiceServicesEmergency departmentNoBeds80LinksWebsiteroyalcornwallhospitals.nhs.uk/our-hospitals/west-cornwall-hospital-penzance/ West Cornwall Hospital is a hospital located in Penzanc...

2008 live album by SlimmySlimmy UnpluggedLive album by SlimmyReleasedNovember 2008(Optimus Store)[1]Recorded19–20 June 2008(Tertúlia Castelense, Maia, Portugal)GenreAcousticLabelOptimusProducerSlimmySlimmy chronology Beatsound Loverboy(2007) Slimmy Unplugged(2008) Be Someone Else(2010) Slimmy Unplugged is the debut live album by Portuguese singer-songwriter Slimmy. It was recorded on 19 and 20 June 2008 at Tertúlia Castelense. It was released and available through Optimus ...

Padre Giovanni da San Guglielmo Padre Giovanni Nicolucci, conosciuto come Giovanni da San Guglielmo (talvolta anche Giovanni da Batignano) (Montecassiano, 15 luglio 1552 – Batignano, 14 agosto 1621), è stato un religioso e presbitero italiano, appartenente alla congregazione dei Frati Scalzi di Sant'Agostino. È stato proclamato venerabile dalla Chiesa cattolica nel 1770 con decreto di papa Clemente XIV. Indice 1 Biografia 1.1 Nascita, giovinezza e vocazione sacerdotale 1.2 Studi e priorat...

Bangladeshi industrial conglomerate Bashundhara GroupNative nameবসুন্ধরা গ্রুপTypePrivateIndustryReal estate, manufacturingFounded1987; 36 years ago (1987)FounderAhmed Akbar SobhanHeadquartersPushpanjali, Bashundhara Convention Center Road, BangladeshProductsCement, tissue, media, LPG, paper, real estate, shopping mall, steel, food & beverage, shippingOwnerAhmed Akbar Sobhan & familyNumber of employees100,000+Websitewww.bashundharagroup.com ...

Matrix operation The Hadamard product operates on identically shaped matrices and produces a third matrix of the same dimensions. In mathematics, the Hadamard product (also known as the element-wise product, entrywise product[1]: ch. 5  or Schur product[2]) is a binary operation that takes in two matrices of the same dimensions and returns a matrix of the multiplied corresponding elements. This operation can be thought as a naive matrix multiplication and is di...

Food and drink company in Uttar Pradesh, India This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Mohan Meakin – news · newspapers · books · scholar · JSTOR (February 2017) (Learn how and when to remove this template message) Mohan MeakinTypePublic limitedTraded asBSE: 590039IndustryBeverages, food process...

Indian politician Arvind Kumar SharmaMember of Parliament, Lok SabhaIncumbentAssumed office 23 May 2019Preceded byDeepender Singh HoodaConstituencyRohtakIn office2004–2014Preceded byIshwar Dayal SwamiSucceeded byAshwini Kumar ChopraConstituencyKarnal Personal detailsBorn (1962-11-25) 25 November 1962 (age 61)M.P. Majra, Punjab, India(now in Haryana, India)Political partyBharatiya Janata Party (2014–present)Other politicalaffiliationsIndian National Congress (till 2014)Spouse Rita...