OR5M9

OR5M9
Ідентифікатори
Символи OR5M9, OR11-190, olfactory receptor family 5 subfamily M member 9
Зовнішні ІД MGI: 3030868 HomoloGene: 51741 GeneCards: OR5M9
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001004743
NM_001011872
RefSeq (білок)
NP_001004743
NP_001011872
Локус (UCSC) Хр. 11: 56.46 – 56.46 Mb Хр. 2: 85.88 – 85.88 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

OR5M9 (англ. Olfactory receptor family 5 subfamily M member 9) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 310 амінокислот, а молекулярна маса — 35 093[4].

Послідовність амінокислот
1020304050
MPNFTDVTEFTLLGLTCRQELQVLFFVVFLAVYMITLLGNIGMIILISIS
PQLQSPMYFFLSHLSFADVCFSSNVTPKMLENLLSETKTISYVGCLVQCY
FFIAVVHVEVYILAVMAFDRYMAGCNPLLYGSKMSRTVCVRLISVPYVYG
FSVSLICTLWTYGLYFCGNFEINHFYCADPPLIQIACGRVHIKEITMIVI
AGINFTYSLSVVLISYTLIVVAVLRMRSADGRRKAFSTCGSHLTAVSMFY
GTPIFMYLRRPTEESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEAVN
KAITKTYVRQ

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Локалізований у клітинній мембрані, мембрані.

Література

  • Malnic B., Godfrey P.A., Buck L.B. (2004). The human olfactory receptor gene family. Proc. Natl. Acad. Sci. U.S.A. 101: 2584—2589. PMID 14983052 DOI:10.1073/pnas.0307882100
  • Malnic B., Godfrey P.A., Buck L.B. (2004). Proc. Natl. Acad. Sci. U.S.A. 101: 7205—7205. {{cite journal}}: Пропущений або порожній |title= (довідка)

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:15294 (англ.) . Процитовано 8 вересня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, Q8NGP3 (англ.) . Архів оригіналу за 3 березня 2016. Процитовано 8 вересня 2017.

Див. також

Read other articles:

István IVIstván IV digambarkan di Kronik PiktumRaja Hungaria dan Kroasiaditentang oleh István IIIBerkuasa1163–1165Penobatan27 Januari 1163PendahuluLászló IIPenerusIstván IIIInformasi pribadiKelahiranskt. 1133Kematian11 April (usia 31-32)Zemun, SerbiaWangsaWangsa ÁrpádAyahBéla II dari HungariaIbuIlonaPasanganMaria KomnenaAgamaKatolik Roma István IV (Hongaria: IV. Istváncode: hu is deprecated , Kroasia: Stjepan IVcode: hr is deprecated , bahasa Slowakia: Štefan IV; skt. 1133&#...

 

Senja di pantai Carpinteria (/kɑːrpɪntəˈriːə/; Spanyol: La Carpinteríacode: es is deprecated ) adalah sebuah kota tepi samudra kecil di tenggara Santa Barbara County, California, timur Santa Barbara dan barat laut Ventura. Populasinya berjumlah 13.040 menurut sensus 2010. Referensi Pranala luar Wikimedia Commons memiliki media mengenai Carpinteria, California. Wikivoyage memiliki panduan wisata Carpinteria. Situs web resmi Movies and television shows filmed in Carpinteria Diarsipkan 2...

 

Šešupė Scheschuppe, ScheschupeSzeszuppe, Szeszupa, Suppe, Шешупе Daten Gewässerkennzahl RU: 01010000112104300007771 Lage Polen Polen Litauen Litauen Russland Russland Kaliningrad Oblast Oblast Kaliningrad Flusssystem Memel Quelle 14 km nordnordwestlich von Suwałki54° 13′ 16″ N, 22° 48′ 57″ O54.221184222.815954190 Quellhöhe ca. 190 m Mündung östlich Neman (Ragnit) in...

Intercollegiate sports teams of Clemson University Clemson TigersUniversityClemson UniversityConferenceAtlantic Coast ConferenceNCAADivision I (FBS)Athletic directorGraham NeffLocationClemson, South CarolinaVarsity teams21Football stadiumMemorial StadiumBasketball arenaLittlejohn ColiseumBaseball stadiumDoug Kingsmore StadiumSoccer stadiumRiggs FieldMascotThe TigerNicknameTigersFight songTiger RagColorsOrange and regalia[1]   Websiteclemsontigers.com Men's spo...

 

Untuk kegunaan lain, lihat dosa. Dosa, dari sudut pandang teologi Kristen, adalah pelanggaran cinta kasih terhadap Tuhan atau sesama yang dapat mengakibatkan terputusnya hubungan antara manusia dengan Allah. Utamanya, dosa disebabkan karena manusia mencintai dirinya sendiri atau hal-hal lain sedemikian rupa sehingga menjauhkan diri dari cinta terhadap Allah. Dosa juga di pandang sebagai perbuatan yang tidak sesuai dengan kehendak Tuhan, baik itu melalui pikiran, perkataan, perbuatan manusia. ...

 

Railway station in Kerala, India This article is about the railway station. For the border village, see Walayar. This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Walayar railway station – news · newspapers · books · scholar · JSTOR (May 2018) (Learn how and when to remove this template message) WalayarRegiona...

Pour les articles homonymes, voir Robbins. Jerome Robbins Jerome Robbins dans Three Virgins and a Devil, photographié en 1941 par Carl van Vechten Données clés Nom de naissance Jerome Rabinowitz Naissance 11 octobre 1918 New York aux États-Unis Décès 29 juillet 1998 (à 79 ans) New York aux États-Unis Lieux de résidence New York Activité principale Chorégraphe, danseur Style Danse moderne, comédie musicale Lieux d'activité New York Années d'activité 1939-1989 Collaboration...

 

LugeAtlet luge Thomas Köhler, 1964Induk organisasiFédération Internationale de Luge de CourseKarakteristikAnggota timperorangan atau tim 2 orangGender campuranYaTempat bertandingLintasan lugeKeberadaanOlimpiade1964 Luge (pengucapan bahasa Inggris: [luːʒ]) adalah kereta salju untuk satu atau dua orang yang dinaiki dengan posisi telentang, kedua belah kaki berada di depan. Kereta dikemudikan dengan menekan bagian alas luncur dengan betis atau sedikit menekan sandaran dengan tubuh bagi...

 

This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Pillai Lokacharya – news · newspapers · books · scholar · JSTOR (January 2017) (Learn how and when to remove this message) Pillai Lokacharyaபிள்ளை லோகாசாரியார்Idol of LokacharyaTitleAcharyaPersonalBorn1205 CETiruchiDied1311 C...

Cet article est une ébauche concernant une commune de la Haute-Corse. Vous pouvez partager vos connaissances en l’améliorant (comment ?). Le bandeau {{ébauche}} peut être enlevé et l’article évalué comme étant au stade « Bon début » quand il comporte assez de renseignements encyclopédiques concernant la commune. Si vous avez un doute, l’atelier de lecture du projet Communes de France est à votre disposition pour vous aider. Consultez également la page d’a...

 

German composer and conductor (1748–1798) Christian Gottlob Neefe Christian Gottlob Neefe (German: [ˈneːfə]; 5 February 1748 – 28 January 1798) was a German opera composer and conductor. He was known as one of the first teachers of Ludwig van Beethoven. Life and career Neefe was born in Chemnitz, Saxony. He received a musical education and started to compose at the age of 12. He studied law at Leipzig University, but subsequently returned to music to become a pupil of the c...

 

هذه المقالة عن المجموعة العرقية الأتراك وليس عن من يحملون جنسية الجمهورية التركية أتراكTürkler (بالتركية) التعداد الكليالتعداد 70~83 مليون نسمةمناطق الوجود المميزةالبلد  القائمة ... تركياألمانياسورياالعراقبلغارياالولايات المتحدةفرنساالمملكة المتحدةهولنداالنمساأسترالي�...

UK advocacy group and membership organisation LibertyThe National Council for Civil LibertiesFormation22 February 1934; 90 years ago (1934-02-22)TypePolitical pressure groupLegal statusTrustFocusHuman rightsHeadquartersLondon, EnglandDirectorAkiko Hart (interim director)Websitewww.libertyhumanrights.org.uk Liberty, formerly, and still formally, called the National Council for Civil Liberties (NCCL),[1] is an advocacy group and membership organisation based in the Uni...

 

Senior military rank of the Israel Defense Forces Rav aluf redirects here. For the military position held by a rav aluf, see Chief of General Staff (Israel). This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Aluf – news · newspapers · books · scholar · JSTOR (April 2021) (Learn how and when to remove this mess...

 

Pour les critères administratifs, voir Chlorure de méthyle (maladie professionnelle). Chlorométhane   Structure du chlorométhane Identification Nom UICPA chlorométhane Synonymes chlorure de méthyle Fréon 40 R40 No CAS 74-87-3 No ECHA 100.000.744 No CE 200-817-4 PubChem 6327 ChEBI 36014 SMILES CCl PubChem, vue 3D InChI InChI : vue 3D InChI=1/CH3Cl/c1-2/h1H3 Apparence gaz incolore à odeur douceâtre Propriétés chimiques Formule CH3Cl  [Isomères] Masse...

Lambang Provinsi Papua Pegunungan Peta lokasi Provinsi Papua Pegunungan di Indonesia Artikel utama: Daftar kabupaten di Indonesia menurut waktu pembentukan Berikut adalah artikel mengenai Daftar kabupaten dan/atau kota di Papua Pegunungan berdasarkan waktu pembentukan yang diurutkan berdasarkan abjad. Referensi berdasarkan Undang-Undang Republik Indonesia yang pertama dikeluarkan saat pembentukan kabupaten/kota tersebut meskipun terdapat perundang-undangan terbaru dikemudian hari. No. KodeKe...

 

Island in Solomon Islands PileniNASA picture of the Reef Islands. Pileni is the island on the right off the northern coastPileniGeographyLocationPacific OceanArchipelagoSolomon IslandsArea0.23 km2 (0.089 sq mi)AdministrationSolomon IslandsDemographicsPopulation200 (2009) Map of the Reef Islands Pileni is a culturally important island in the Reef Islands, Temotu Province, in the independent nation of Solomon Islands. Despite its location in Melanesia, the population of the islan...

 

Type of fostering allegiance formed during nursing by a non-biological mother Part of a series on theAnthropology of kinship Basic concepts Family Lineage Affinity Consanguinity Marriage Incest taboo Endogamy Exogamy Moiety Monogamy Polygyny Polygamy Concubinage Polyandry Bride price Bride service Dowry Parallel / cross cousins Cousin marriage Levirate Sororate Posthumous marriage Joking relationship Clan Cohabitation Fictive / Milk / Nurture kinship Descent Cognati...

جامع العسافي إحداثيات 33°22′39″N 44°22′23″E / 33.377555555556°N 44.373194444444°E / 33.377555555556; 44.373194444444   معلومات عامة القرية أو المدينة بغداد / الرصافة الدولة العراق تاريخ بدء البناء 1376هـ/1956م المواصفات المساحة 2000م2 عدد المصلين 2000 عدد المآذن 1 عدد القباب 1 التفاصيل التقنية المواد �...

 

Wappen der Grafen von Barcelona Die Grafschaft Barcelona, auf Katalanisch Comtat de Barcelona, war eine der historischen katalanischen Grafschaften, welche die Franken in der Spanischen Mark errichteten. Neben Barcelona und Umgebung umfasste die Grafschaft auch das Gebiet von Terrassa und das der heutigen Comarques Vallès Oriental und Occidental, das Maresme und Penedès. Inhaltsverzeichnis 1 Ursprünge 2 Die fränkische Herrschaft (9. Jahrhundert) 3 Die Vereinigung mit Girona und Osona 4 Di...