OR7C2

OR7C2
Ідентифікатори
Символи OR7C2, CIT-HSP-87M17, OR19-18, OR7C3, olfactory receptor family 7 subfamily C member 2, olfactory receptor family 7 subfamily C member 2 (gene/pseudogene)
Зовнішні ІД MGI: 3031190 HomoloGene: 71958 GeneCards: OR7C2
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_012377
NM_146308
RefSeq (білок)
NP_036509
NP_666420
Локус (UCSC) Хр. 19: 14.94 – 14.94 Mb Хр. 10: 78.68 – 78.69 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

OR7C2 (англ. Olfactory receptor family 7 subfamily C member 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 319 амінокислот, а молекулярна маса — 35 323[4].

Послідовність амінокислот
1020304050
MERGNQTEVGNFLLLGFAEDSDMQLLLHGLFLSMYLVTIIGNLLIILTIS
SDSHLHTPMYFFLSNLSFADICFTSTTVPKMLVNIQTQSKMITFAGCLTQ
IFFFIAFGCLDNLLLTMTAYDRFVAICYPLHYTVIMNPRLCGLLVLGSWC
ISVMGSLLETLTILRLSFCTNMEIPHFFCDPSEVLKLACSDTFINNIVMY
FVTIVLGVFPLCGILFSYSQIFSSVLRVSARGQHKAFSTCGSHLSVVSLF
YGTGLGVYLSSAVTPPSRTSLAASVMYTMVTPMLNPFIYSLRNKDMKGSL
GRLLLRATSLKEGTIAKLS

Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, білків внутрішньоклітинного сигналінгу. Локалізований у клітинній мембрані, мембрані.

Література

  • Malnic B., Godfrey P.A., Buck L.B. (2004). The human olfactory receptor gene family. Proc. Natl. Acad. Sci. U.S.A. 101: 2584—2589. PMID 14983052 DOI:10.1073/pnas.0307882100
  • Malnic B., Godfrey P.A., Buck L.B. (2004). Proc. Natl. Acad. Sci. U.S.A. 101: 7205—7205. {{cite journal}}: Пропущений або порожній |title= (довідка)

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:8374 (англ.) . Процитовано 12 вересня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, O60412 (англ.) . Архів оригіналу за 2 грудня 2016. Процитовано 12 вересня 2017.

Див. також

Read other articles:

Río Americano Río de los Americanos National Natural Landmark Ubicación geográficaCuenca cuenca hidrográfica del SacramentoDesembocadura Río SacramentoCoordenadas 38°42′36″N 121°09′29″O / 38.71, -121.15805555556Ubicación administrativaPaís Estados UnidosDivisión CaliforniaCuerpo de aguaLongitud 225 kmSuperficie de cuenca 5.568 km²[editar datos en Wikidata] El río de los Americanos[1]​ originalmente llamado Río Buenaventura es un curso de a...

John White Alexander Información personalNacimiento 7 de octubre de 1856 Allegheny (Estados Unidos) Fallecimiento 31 de mayo de 1915 (58 años)Nueva York (Estados Unidos) Sepultura Cementerio de Princeton Nacionalidad EstadounidenseLengua materna Inglés FamiliaCónyuge Elizabeth Alexander Alexander Información profesionalOcupación Ilustrador, pintor y artista visual Área Pintura, artes visuales e ilustración Movimiento Modernismo Género Retrato y pintura del paisaje Miembro de Academia...

Municipio de Dale Municipio Municipio de DaleUbicación en el condado de Atchison en Misuri Ubicación de Misuri en EE. UU.Coordenadas 40°19′17″N 95°14′54″O / 40.321388888889, -95.248333333333Entidad Municipio • País  Estados Unidos • Estado  Misuri • Condado AtchisonSuperficie   • Total 211.39 km² • Tierra 211.35 km² • Agua (0.02 %) 0.03 km²Altitud   • Media 296 m s. n. m.Población&#...

France Info Eslogan Et tout est plus clair. (Todo es más claro)[1]​Programación NoticiasPropietario Gobierno francésOperado por France TélévisionsPaís  FranciaIdioma FrancésFundación 1 de septiembre de 2016Inicio de transmisiones 1 de septiembre de 2016 (7 años)Formato de imagen 1080i HDTV(reescalado a 16:9 576i para la señal en resolución estándar)Área de transmisión Francia metropolitanaUbicación ParísSitio web francetvinfo.fr[editar datos en Wikidata&#x...

Fortaleza e municípios vizinhos. O meio ambiente de Fortaleza tem características semelhantes aos que ocorrem em todo o litoral do Brasil. O clima é ameno com temperatura anual média de 26°C. A vegetação predominante é de mangue e restinga tendo o Parque Ecológico do Cocó como a maior área verde da cidade. Seu relevo tem altitude média de quinze metros e o maior rio é o Cocó. A instituição que tem a competência de promover e executar a política municipal de meio ambiente é ...

◄ WTA Tour 2010 ► Zeitraum: 3. Januar – 7. November 2010 Auflage: 40 Anzahl der Turniere: 57 Kategorien: Grand Slam (4)WTA Championships (2)WTA Premier Mandatory (4)WTA Premier 5 (5)WTA Premier (10)WTA International (32) Erfolge Meiste Turniersiege: Danemark Caroline Wozniacki (6) Meiste Finalteilnahmen: Danemark Caroline Wozniacki (8) Meistes Preisgeld: Belgien Kim Clijsters (5.035.060 $) Meiste Punkte: Danemark Caroline Wozniacki (7.270) Auszeichnungen Spielerin de...

Indian web series For the 2008 BBC series, see Criminal Justice (British TV series). Criminal JusticePromotional posterGenreCrimeThrillerLegal dramaWritten byShridhar RaghavanDirected byTigmanshu DhuliaVishal FuriaStarringPankaj Tripathi Vikrant MasseyJackie ShroffAnupriya Goenka Mita VashishtPankaj SaraswatRucha Inamdar Madhurima Roy ComposerSameer PhaterpekarCountry of originIndiaOriginal languageHindiNo. of seasons3No. of episodes10 (list of episodes)ProductionExecutive producers Siddharth...

June ClydeClyde in A Study in Scarlet, 1933LahirIna Parton(1909-12-02)2 Desember 1909Maysville, Missouri, A.S.Meninggal1 Oktober 1987(1987-10-01) (umur 77)Fort Lauderdale, Florida, A.S.KebangsaanAmerikaPekerjaanPenyanyi, aktrisTahun aktif1916-1957 June Clyde (nee Ina Parton, 2 Desember 1909 – 1 Oktober 1987) adalah seorang aktris, penyanyi dan penari Amerika, yang dikenal karena perannya dalam film pra-Kode seperti A Strange Adventure (1932) dan A Study in Scarlet (1...

2023 Four Days of Dunkirk تفاصيل السباقسلسلة67. أربعة أيام من دونكيركمنافسةسلسلة سباقات الاتحاد الدولي للدراجات للمحترفين 2023 2.Pro‏مراحل6التواريخ16 – 21 مايو 2023المسافات926٫5 كمالبلد فرنسانقطة البدايةدونكيركنقطة النهايةدونكيركالفرق20عدد المتسابقين في البداية140عدد المتسابقين في النه�...

American college football season 1970 Auburn Tigers footballGator Bowl championGator Bowl, W 35–28 vs. Ole MissConferenceSoutheastern ConferenceRankingCoachesNo. 9APNo. 10Record9–2 (5–2 SEC)Head coachRalph Jordan (20th season)CaptainRonnie RossHome stadiumCliff Hare StadiumLegion FieldSeasons← 19691971 → 1970 Southeastern Conference football standings vte Conf Overall Team W   L   T W   L   T No. 7 LSU $ 5 – 0 – 0...

This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Falcon Marching Band – news · newspapers · books · scholar · JSTOR (December 2009) (Learn how and when to remove this template message) Bowling Green State University Falcon Marching BandSchoolBowling Green State UniversityLocationBowling Green, OhioConferenceM...

У Вікіпедії є статті про інші значення цього терміна: Олива. Олег ОливаОлег Русланович Олива  МайорЗагальна інформаціяНародження 26 червня 1998(1998-06-26) (25 років)Національність українецьAlma Mater Військова академія (Одеса)Військова службаПриналежність  УкраїнаВид ЗС Сухо�...

Defunct public body for police oversight in England and Wales This article is about the British agency. For the agency in Hong Kong, see Independent Police Complaints Council. For other similarly named organisations, see List of police complaints authorities. This article needs to be updated. Please help update this article to reflect recent events or newly available information. (January 2018) Independent Police Complaints CommissionAbbreviationIPCCPredecessorPolice Complaints AuthoritySucce...

Airport in Fort Worth, TexasGreater Southwest International AirportIATA: GSWICAO: KGSWFAA LID: GSWSummaryAirport typePublicOwnerAbandonedOperatorAllied Fueling CompanyLocationFort Worth, TexasElevation AMSL568 ft / 173 mCoordinates32°49′53″N 097°02′57″W / 32.83139°N 97.04917°W / 32.83139; -97.04917Runways Direction Length Surface ft m 17/35 8,460 2,579 Concrete 13/31 6,400 1,951 Concrete Greater Southwest International Airport (IATA: GSW, ICA...

رومان جبافي معلومات شخصية الميلاد 16 نوفمبر 1989 (العمر 34 سنة)تشيكوسلوفاكيا الطول 185 سنتيمتر  الإقامة التشيكبراغ  الجنسية  جمهورية التشيك الوزن 90 كيلوغرام  استعمال اليد اليد اليمنى الحياة العملية مجموع الجوائز المادية 110259 دولار بلد الرياضة التشيك  فردي السجل(ف-خ)...

Season of television series JustifiedSeason 1Season 1 DVD coverCountry of originUnited StatesNo. of episodes13ReleaseOriginal networkFXOriginal releaseMarch 16 (2010-03-16) –June 8, 2010 (2010-06-08)Season chronologyNext →Season 2 List of episodes The first season of the American neo-Western[1] television series Justified premiered on March 16, 2010, on FX, and concluded on June 8, 2010, consisting of 13 episodes.[2][3] The series was developed ...

Polish electropop music duo This article is about the musical group. For the television series, see The Dumplings (TV series). The DumplingsThe Dumplings performing in Kraków, 2015Background informationOriginZabrze, PolandGenresElectropopYears active2011 (2011)–presentLabelsWarner Music PolandMembersJustyna ŚwięsKuba Karaś The Dumplings are a Polish electropop duo from Zabrze, consisting of Justyna Święs and Kuba Karaś. As of 2016, they have released two studio albums. Their deb...

Athletic teams that represent DePaul University DePaul Blue DemonsUniversityDePaul UniversityConferenceBig East ConferenceNCAADivision IAthletic directorDeWayne PeevyLocationChicago, IllinoisVarsity teams15 (7 men’s and 8 women’s)Basketball arenaWintrust ArenaSoftball stadiumCacciatore StadiumSoccer stadiumWish FieldOther venuesLakeshore Sport and FitnessLane StadiumMcGrath-Phillips ArenaRuffled Feathers Golf ClubMascotDIBSNicknameBlue DemonsFight songBlue Demons Fight SongColorsRoyal blu...

Pizzeria chain in the United States This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Mountain Mike's Pizza – news · newspapers · books · scholar · JSTOR (Au...

Variety of monzonite, an igneous rock LarvikiteIgneous rockLarvikite from Larvik, NorwayCompositionPlagioclase, alkali feldspar, amphibole A larvikite quarry in Larvik, Norway, 2008 Polished larvikite (marketed as Blue Pearl Granite), showing labradorescence, is a popular decorative stone. Light larvikite with a polished surface Larvikite is an igneous rock, specifically a variety of monzonite,[1] notable for the presence of thumbnail-sized crystals of feldspar. These feldspars are kn...