JAM2

JAM2
Ідентифікатори
Символи JAM2, C21orf43, CD322, JAM-B, JAMB, PRO245, VE-JAM, VEJAM, junctional adhesion molecule 2, IBGC8
Зовнішні ІД OMIM: 606870 MGI: 1933820 HomoloGene: 10929 GeneCards: JAM2
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001270407
NM_001270408
NM_021219
NM_023844
RefSeq (білок)
NP_001257336
NP_001257337
NP_067042
NP_076333
Локус (UCSC) Хр. 21: 25.64 – 25.72 Mb Хр. 16: 84.57 – 84.62 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

JAM2 (англ. Junctional adhesion molecule 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 21-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 298 амінокислот, а молекулярна маса — 33 207[4].

Послідовність амінокислот
1020304050
MARRSRHRLLLLLLRYLVVALGYHKAYGFSAPKDQQVVTAVEYQEAILAC
KTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVT
RSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTV
VELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQ
FNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNISGIIAAVVVVALV
ISVCGLGVCYAQRKGYFSKETSFQKSNSSSKATTMSENDFKHTKSFII

Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані, клітинних контактах, щільних контактах.

Література

  • Palmeri D., van Zante A., Huang C.-C., Hemmerich S., Rosen S.D. (2000). Vascular endothelial junction-associated molecule, a novel member of the immunoglobulin superfamily, is localized to intercellular boundaries of endothelial cells. J. Biol. Chem. 275: 19139—19145. PMID 10779521 doi:10.1074/jbc.M003189200
  • Gardiner K., Slavov D., Bechtel L., Davisson M. (2002). Annotation of human chromosome 21 for relevance to Down syndrome: gene structure and expression analysis. Genomics. 79: 833—843. PMID 12036298 doi:10.1006/geno.2002.6782
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 doi:10.1101/gr.2596504
  • Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 13: 2819—2824. PMID 15340161 doi:10.1110/ps.04682504
  • Arrate M.P., Rodriguez J.M., Tran T.M., Brock T.A., Cunningham S.A. (2001). Cloning of human junctional adhesion molecule 3 (JAM3) and its identification as the JAM2 counter-receptor. J. Biol. Chem. 276: 45826—45832. PMID 11590146 doi:10.1074/jbc.M105972200
  • Muller W.A. (2003). Leukocyte-endothelial-cell interactions in leukocyte transmigration and the inflammatory response. Trends Immunol. 24: 327—334. PMID 12810109 doi:10.1016/S1471-4906(03)00117-0

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:14686 (англ.) . Процитовано 12 вересня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, P57087 (англ.) . Архів оригіналу за 1 січня 2017. Процитовано 12 вересня 2017.

Див. також

Read other articles:

The Trump OrganizationTrump Tower, markas The Trump OrganizationJenisPerusahaan swastaIndustriKonglomeratDidirikan1923; 101 tahun lalu (1923)(dengan nama Elizabeth Trump & Son[1])PendiriElizabeth dan Fred TrumpKantorpusatTrump Tower, New York CityWilayah operasiSeluruh duniaTokohkunci Donald Trump (Ketua & Presiden) Donald Trump Jr. (Wakil Presiden Eksekutif) Ivanka Trump (WPE) Eric Trump (WPE) Michael D. Cohen (WPE)[2] Jason Greenblatt (WPE)[3] Allen Weis...

 

BuliDesaNegara IndonesiaProvinsiMaluku UtaraKabupatenHalmahera TimurKecamatanMabaKode pos97862Kode Kemendagri82.06.02.2001 Luas... km²Jumlah penduduk... jiwaKepadatan... jiwa/km² Rumah misionaris di Buli pada tahun 1905-1914 Buli adalah salah satu desa di kecamatan Maba, Kabupaten Halmahera Timur, provinsi Maluku Utara, Indonesia. Pranala luar (Indonesia) Keputusan Menteri Dalam Negeri Nomor 050-145 Tahun 2022 tentang Pemberian dan Pemutakhiran Kode, Data Wilayah Administrasi Pemerinta...

 

Japanese professional wrestling promotion Pro Wrestling NoahFoundedJune 16, 2000StyleRoyal Road with Ark[1]HeadquartersShinjuku, Tokyo, JapanFounder(s)Mitsuharu MisawaParentCyberFight(CyberAgent)SisterPro Wrestling SemDDT Pro-WrestlingTokyo Joshi Pro WrestlingGanbare Pro-WrestlingSplit fromAll Japan Pro WrestlingWebsiteOfficial website Part of a series onProfessional wrestling History History of professional wrestling By year Early wrestling championships Gold Dust Trio 1980s boom Bla...

Syaiful Sulun Panglima Kodam V/BrawijayaMasa jabatan1985–1987 PendahuluSoelarsoPenggantiSugeng Subroto Informasi pribadiLahir6 Januari 1937 (umur 87)Medan, Sumatera UtaraSuami/istriNy. Zulfikar Mahadi (Almh.)AnakBrigjen TNI Primadi Saiful Sulun, S.Sos., M.Si.ErwinErwinaKarier militerPihak IndonesiaDinas/cabang TNI Angkatan DaratMasa dinas1960—1992Pangkat Letnan Jenderal TNISatuanInfanteriPertempuran/perangOperasi Militer Trikora 1963Sunting kotak info • L • B ...

 

Lo Scandalo Scaramella fu l'illecito criminoso che comportò la retrocessione a tavolino del Catania nel 1955. I fatti Lo scandalo nacque dalle dichiarazioni dello stesso intermediatore dell'illecito, Giulio Sterlini, che indicò come falsate le gare in cui i siciliani avevano ospitato l'Atalanta il 22 dicembre 1954 e il Genoa il 6 marzo 1955. Sterlini ammise agli inquirenti di aver contattato Salvatore Berardelli per aiutarlo a corrompere suo cognato l'arbitro Ugo Scaramella, personaggio per...

 

British Overseas Territory in the South Atlantic Ocean This article is about the island in the South Atlantic Ocean. For the Canadian islands, see Ascension Islands. Place in United KingdomAscension IslandConstituent part of Saint Helena, Ascension and Tristan da Cunha FlagCoat of armsAnthem: God Save the KingTopographic map of Ascension IslandLocation of Ascension Island in the southern Atlantic OceanSovereign state United KingdomBritish settlement1815Dependency of Saint Helena12 Septem...

This article relies excessively on references to primary sources. Please improve this article by adding secondary or tertiary sources. Find sources: Menorah Medical Center – news · newspapers · books · scholar · JSTOR (May 2019) (Learn how and when to remove this template message) Hospital in Kansas, United StatesMenorah Medical CenterHCA Midwest DivisionGeographyLocation5721 W. 119th Street, Overland Park, Kansas, United StatesOrganizationNetworkHCA M...

 

1980 American documentary film The Day After TrinityDVD cover, 2002, with photograph by Philippe Halsman, 1958Directed byJon H. ElseWritten byDavid PeoplesJanet PeoplesJon ElseProduced byJon H. Else[1]Peter Baker(executive producer)StarringHans BetheRobert SerberRobert WilsonFrank OppenheimerI.I. RabiFreeman DysonStanislaw UlamJ. Robert Oppenheimer (archive footage)Narrated byPaul FreesCinematographyTom McDonoughDavid EsparStephen LighthillEdited byDavid PeoplesRalph WikkeMusic byMart...

 

Campeonato ParaenseSport Calcio Tiposquadre di club FederazioneFederação Paraense de Futebol Paese Pará, Brasile TitoloCampione dello stato di Pará Cadenzaannuale Partecipanti10 Sito Internetwww.fpfpara.com.br StoriaFondazione1908 Detentore Paysandu Record vittorie Paysandu (48) Trofeo o riconoscimento Modifica dati su Wikidata · Manuale Il Campeonato Paraense è il campionato di calcio dello stato di Pará, in Brasile. Si svolge dal 1908, dagli anni settanta è ...

† Человек прямоходящий Научная классификация Домен:ЭукариотыЦарство:ЖивотныеПодцарство:ЭуметазоиБез ранга:Двусторонне-симметричныеБез ранга:ВторичноротыеТип:ХордовыеПодтип:ПозвоночныеИнфратип:ЧелюстноротыеНадкласс:ЧетвероногиеКлада:АмниотыКлада:Синапсиды�...

 

نادي شافهاوزن تأسس عام 1896  البلد سويسرا  الموقع الرسمي الموقع الرسمي  تعديل مصدري - تعديل   نادي شافهاوزن لكرة القدم (بالألمانية: FC Schaffhausen AG) نادي كرة قدم سويسري يلعب في دوري التحدي السويسري.[1][2][3] تم تأسيس النادي في عام 1896. مراجع ^ معلومات عن نادي شافهاو...

 

Set of laws implemented in Nazi Germany Eva Justin of the Racial Hygiene and Demographic Biology Research Unit measuring the skull of a Romani woman Part of a series onNazism Organizations Ahnenerbe Geheime Staatspolizei Deutsches Jungvolk Hitler Youth League of German Girls NSDÄB NSDStB NSRL NSFK NSKK NSF Nationalsozialistische Monatshefte Nazi Party Sturmabteilung (SA) Schutzstaffel (SS) History Early timeline National Socialist Program Hitler's rise to power Machtergreifung German rearmam...

Ariella CalistaLahirAriella Calista12 Mei 2000 (umur 23)Jakarta, IndonesiaPendidikanSMP Kristen Ketapang 1, SMA Kristen Ketapang 1AlmamaterUniversitas Atma Jaya JakartaPekerjaanModelPenyanyiAktrisPenariSuami/istriWelly Surya ​(m. 2023)​KerabatEve Antoinette Ichwan (adik)Karier musikGenrePopInstrumenVokal, biolaTahun aktif2008–sekarangArtis terkaitJKT48Mantan anggotaJKT48 (2018–2022)Situs webJKT48 Ariella Calista Ichwan (lahir 12 Mei 2000) adalah salah se...

 

Area codes in southeastern Pennsylvania Pennsylvania (blue) with numbering plan area 215 shown in red. Area codes 215, 267, and 445 are telephone area codes in the North American Numbering Plan (NANP) for Philadelphia and adjacent portions of Bucks and Montgomery counties in the U.S. state of Pennsylvania. Area code 215 was one of the original North American area codes established in 1947, while 267 and 445 are overlay codes for the same numbering plan area (NPA). History When the American Te...

 

The northern cardinal is the state bird of Ohio. This list of birds of Ohio includes species documented in the U.S. state of Ohio and accepted by Ohio Bird Records Committee (OBRC). As of December 2023, there were 450 species on the official list.[1] Of them, 193 have been documented as breeding in the state,[2] and 123 are review species as defined below.[3] Eight species found in Ohio have been introduced to North America. Two species on the list are extinct, two mo...

Artikel ini tidak memiliki referensi atau sumber tepercaya sehingga isinya tidak bisa dipastikan. Tolong bantu perbaiki artikel ini dengan menambahkan referensi yang layak. Tulisan tanpa sumber dapat dipertanyakan dan dihapus sewaktu-waktu.Cari sumber: Shin Byung-hyun – berita · surat kabar · buku · cendekiawan · JSTOR Artikel ini perlu dikembangkan agar dapat memenuhi kriteria sebagai entri Wikipedia.Bantulah untuk mengembangkan artikel ini. Jika tida...

 

Fictitious character in Masonic allegory, based on Old Testament character Part of a series onFreemasonry Overview Grand Lodge Masonic lodge Masonic lodge officers Grand Master Prince Hall Freemasonry Regular Masonic jurisdiction Anglo-American Freemasonry Continental Freemasonry History History of Freemasonry Liberté chérie Masonic manuscripts Masonic bodies Masonic Masonic bodies York Rite Order of Mark Master Masons Holy Royal Arch Royal Arch Masonry Cryptic Masonry Knights Templar Red C...

 

National park in Indonesia Komodo National ParkTaman Nasional KomodoIUCN category II (national park)Komodo dragon at Komodo National ParkKomodo NPLocationLesser Sunda Islands, IndonesiaCoordinates8°32′36″S 119°29′22″E / 8.54333°S 119.48944°E / -8.54333; 119.48944Area1,733 km2 (669 sq mi)[1]Established1980Visitors45,000 (in 2010)Governing bodyMinistry of Environment and ForestryWebsitewww.komodonationalpark.org UNESCO Wor...

В Википедии есть статьи о других людях с фамилией Искандер. Фазиль Искандер Имя при рождении Фазильбей Абдулович Искандер Полное имя Фазиль Абдулович Искандер Дата рождения 6 марта 1929(1929-03-06)[1][2][…] Место рождения Сухум, Социалистическая Советская Республика Г...

 

سنتر هاربور     الإحداثيات 43°42′29″N 71°27′49″W / 43.708055555556°N 71.463611111111°W / 43.708055555556; -71.463611111111   [1] تقسيم إداري  البلد الولايات المتحدة[2]  التقسيم الأعلى مقاطعة بلكنابمقاطعة كارول  خصائص جغرافية  المساحة 42.8 كيلومتر مربع  ارتفاع 169 متر  عد�...