TNFRSF11A

TNFRSF11A
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TNFRSF11A, tumor necrosis factor receptor superfamily, member 11a, NFKB activator, CD265, FEO, LOH18CR1, ODFR, OFE, OPTB7, OSTS, PDB2, RANK, TRANCER, tumor necrosis factor receptor superfamily member 11a, TNF receptor superfamily member 11a, TRANCE-R
Зовнішні ІД OMIM: 603499 MGI: 1314891 HomoloGene: 2848 GeneCards: TNFRSF11A
Пов'язані генетичні захворювання
Polyostotic osteolytic dysplasia, hereditary expansile, autosomal recessive osteopetrosis 7[1]
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001270949
NM_001270950
NM_001270951
NM_001278268
NM_003839
NM_009399
RefSeq (білок)
NP_001257878
NP_001257879
NP_001257880
NP_001265197
NP_003830
NP_033425
Локус (UCSC) Хр. 18: 62.33 – 62.39 Mb Хр. 1: 105.71 – 105.78 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TNFRSF11A (англ. TNF receptor superfamily member 11a) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 18-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 616 амінокислот, а молекулярна маса — 66 034[5].

Послідовність амінокислот
1020304050
MAPRARRRRPLFALLLLCALLARLQVALQIAPPCTSEKHYEHLGRCCNKC
EPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVA
VVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTV
CKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPA
RKPPNEPHVYLPGLIILLLFASVALVAAIIFGVCYRKKGKALTANLWHWI
NEACGRLSGDKESSGDSCVSTHTANFGQQGACEGVLLLTLEEKTFPEDMC
YPDQGGVCQGTCVGGGPYAQGEDARMLSLVSKTEIEEDSFRQMPTEDEYM
DRPSQPTDQLLFLTEPGSKSTPPFSEPLEVGENDSLSQCFTGTQSTVGSE
SCNCTEPLCRTDWTPMSSENYLQKEVDSGHCPHWAASPSPNWADVCTGCR
NPPGEDCEPLVGSPKRGPLPQCAYGMGLPPEEEASRTEARDQPEDGADGR
LPSSARAGAGSGSSPGGQSPASGNVTGNSNSTFISSGQVMNFKGDIIVVY
VSQTSQEGAAAAAEPMGRPVQEETLARRDSFAGNGPRFPDPCGGPEGLRE
PEKASRPVQEQGGAKA

Кодований геном білок за функціями належить до рецепторів, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном натрію. Локалізований у клітинній мембрані, мембрані.

Література

  • Sirinian C., Papanastasiou A.D., Zarkadis I.K., Kalofonos H.P. (2013). Alternative splicing generates a truncated isoform of human TNFRSF11A (RANK) with an altered capacity to activate NF-kappaB. Gene. 525: 124—129. PMID 23664977 DOI:10.1016/j.gene.2013.04.075

Примітки

  1. Захворювання, генетично пов'язані з TNFRSF11A переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:11908 (англ.) . Архів оригіналу за 31 березня 2016. Процитовано 12 вересня 2017.
  5. UniProt, Q9Y6Q6 (англ.) . Архів оригіналу за 7 серпня 2017. Процитовано 12 вересня 2017.

Див. також

Read other articles:

محمد الصالح الجابري الأديب محمد الصالح الجابري معلومات شخصية الميلاد 14 فبراير 1940(1940-02-14)توزر،  تونس الوفاة 19 يونيو 2009 (69 سنة)أريانة,  تونس الجنسية  تونس الحياة العملية المهنة باحث وأديب أعمال بارزة ليلة السنوات العشريوم من أيام زمرا بوابة الأدب تعديل مصدري - تعديل  

  لمعانٍ أخرى، طالع الحفيرة (توضيح). الحفيرة موقع محافظة الدوادمي بالنسبة لمنطقة الرياض تقسيم إداري البلد  السعودية التقسيم الأعلى منطقة الرياض  إحداثيات 24°26′51″N 44°42′24″E / 24.4475°N 44.706667°E / 24.4475; 44.706667  السكان التعداد السكاني غير معروف نسمة (إحصاء ) تعد

Ini adalah nama Minahasa, marganya adalah Rompies Vincent RompiesVincent di Tonight ShowLahirVincent Ryan Rompies29 Maret 1980 (umur 43)Jakarta, IndonesiaAlmamaterInstitut Kesenian JakartaPekerjaanMusisiPresenterPemeranKomedianTahun aktif2005—sekarangSuami/istriIrfita Karina Karamoy ​ ​(m. 2005)​Anak3Karier musikGenreSynthpopnew waverock alternatifpost punkpunkInstrumenBassgitarAnggotaThe CashThe PrediksiGoodnight ElectricMantan anggotaClubeighti...

У Вікіпедії є статті про інші значення цього терміна: Тійода. Координати: 35°41′37″ пн. ш. 139°45′07″ сх. д. / 35.6938694° пн. ш. 139.7520889° сх. д. / 35.6938694; 139.7520889 Чийода Прапор Країна Японія Острів Хонсю Регіон Канто Префектура  Токіо ISO 3166-2 13101-6 Площа 11,64...

Achille Mbembe Información personalNacimiento 1957 CamerúnResidencia Johannesburgo Nacionalidad camerunesaFamiliaCónyuge Sarah Nuttall EducaciónEducación doctorado (en Francia) Educado en Instituto de Estudios Políticos de ParísUniversidad París I Panthéon-Sorbonne (Doc. en Historical science; hasta 1989) Supervisor doctoral Catherine Coquery-Vidrovitch Información profesionalOcupación Historiador, teórico políticoCargos ocupados Secretario general de Consejo para el Desarro...

Surp Hovhannes Church Սուրբ Յովհաննէս ԵկեղեցիThe basilica of S. Hovhannes at Voskevaz.ReligionAffiliationArmenian Apostolic ChurchLocationLocationVoskevaz village, Aragatsotn Province,  ArmeniaShown within ArmeniaGeographic coordinates40°16′24″N 44°17′54″E / 40.27328°N 44.29825°E / 40.27328; 44.29825ArchitectureTypeBasilicaStyleArmenianCompleted7th to 12th centuriesDome(s)1, now collapsed Surp Hovhannes (Armenian: Սուրբ Յովհ

Saint Barnabas Greek Orthodox Church Saint Barnabas Greek Orthodox Church is a Greek Orthodox church in Finsbury Road, Wood Green, London.[1] References ^ The Greek Orthodox Church of St. Barnabas. Archdiocese of Thyateira and Great Britain. Retrieved 5 April 2016. External links Wikimedia Commons has media related to Saint Barnabas Greek Orthodox Church, Wood Green. Official website vteChurches in Haringeyancient parishchurches (pre-1800) All Hallows, Tottenham St Mary, Hornsey Angli...

Fishing village on the coast of False Bay, and a suburb of Cape Town, Western Cape, South Africa Place in Western Cape, South AfricaKalk Bay KalkbaaiKalk Bay as seen from the railwayKalk BayShow map of Western CapeKalk BayShow map of South AfricaKalk BayShow map of AfricaCoordinates: 34°07′40″S 18°26′54″E / 34.12778°S 18.44833°E / -34.12778; 18.44833CountrySouth AfricaProvinceWestern CapeMunicipalityCity of Cape TownMain PlaceCape TownGovernment •...

RuPaul discographyRuPaul at a party for the launch of the Starrbooty DVDStudio albums15Compilation albums6Music videos42EPs4Singles68Soundtrack albums4Remix albums5Promotional singles13 American singer RuPaul has released fourteen studio albums, four soundtrack albums, six compilation albums, five remix albums, and four extended plays. RuPaul has also released 68 singles, forty-two music videos and thirteen promotional singles. RuPaul reached commercial success in the United States with his d...

У этого термина существуют и другие значения, см. Белуджистан (значения). ПровинцияБелуджистанурду بلوچستان‎белудж. بلوچستانангл. Balochistan Флаг Герб 30°07′ с. ш. 67°01′ в. д.HGЯO Страна Пакистан Включает 30 округов Адм. центр Кветта Губернатор Сайед Захур Ахмад Аг�...

American businessman Sam ZemurrayZemurray in 1934BornSchmuel Zmurri(1877-01-18)January 18, 1877Kishinev, Bessarabia Governorate, Russian Empire(present-day Chișinău, Moldova)DiedNovember 30, 1961(1961-11-30) (aged 84)New Orleans, Louisiana, U.S.OccupationProduce magnateKnown forLeading the United Fruit CompanySpouse Sarah Weinberger ​(m. 1908)​ChildrenDoris Zemurray Stone, Samuel Zemurray Jr. Samuel Zemurray (born Schmuel Zmurri; January 18, 1877 – N...

Star cluster orbiting Sagittarius A* Inferred orbits of 6 stars around supermassive black hole candidate Sagittarius A* at the Milky Way's center[1] The Sagittarius A* cluster is the cluster of stars in close orbit around Sagittarius A*, the supermassive black hole at the center of the Milky Way (in the Galactic Center). The individual stars are often listed as S-stars, but their names and IDs are not formalized, and stars can have different numbers in different catalogues. One of the...

This article possibly contains original research. Please improve it by verifying the claims made and adding inline citations. Statements consisting only of original research should be removed. (May 2023) (Learn how and when to remove this template message) The following is a family tree of the monarchs of Russia. Rurik dynasty Rurik dynasty Legend:   - Grand Princes of Kiev   - Grand Princes of Vladimir   - Princes of Novgorod   - Grand Princes of Moscow   - Tsar...

Academic journalRNA BiologyDisciplineRNALanguageEnglishEdited byRenée SchroederPublication detailsHistory2004-presentPublisherTaylor & FrancisFrequencyQuarterlyImpact factor4.766 (2021)Standard abbreviationsISO 4 (alt) · Bluebook (alt1 · alt2)NLM (alt) · MathSciNet (alt )ISO 4RNA Biol.IndexingCODEN (alt · alt2) · JSTOR (alt) · LCCN (alt)MIAR · NLM (alt) · ScopusISSN1547-62...

American freight and package delivery company Federal Express redirects here. For the former train line, see Federal Express (train). FedEx CorporationA FedEx McDonnell Douglas DC-10, with a FedEx delivery truck in the foregroundTrade nameFDXFormerlyFederal Express Corporation​ (1971–1997)FDX Corporation​ (1997–2000)TypePublicTraded asNYSE: FDXDJTA componentS&P 100 componentS&P 500 componentISINUS31428X1063IndustryE-commerceServicesTransportationFoundedM...

Defunct lesbian bar in Portland, Oregon, U.S. The Egyptian ClubEgyptian Room, E-RoomLogo on venue signageThe Egyptian ClubLocation in Portland, OregonAddress3701 Southeast Division StreetLocationPortland, Oregon, United StatesCoordinates45°30′18″N 122°37′32″W / 45.50489°N 122.62560°W / 45.50489; -122.62560OwnerKim DavisTypeGay barOpened1995 (1995)Closed2010 (Egyptian Room)2011 (Weird Bar) The Egyptian Club, also known as Egyptian Room and referred to c...

Серия телесериала «Легенда о Корре»Затаившийся врагангл. The Terror Within Банда Захира похитила Корру Основная информация Номер серии Сезон 3Серия 8 Режиссёр Колин Хек Автор сценария Джошуа Хэмилтон Дата выхода 25 июля 2014 Длительность 22 минуты Приглашённые актёры Джоу�...

American football player (born 1975) This article may need to be rewritten to comply with Wikipedia's quality standards. You can help. The talk page may contain suggestions. (May 2016) American football player Lamar KingNo. 92Position:Defensive endPersonal informationBorn: (1975-08-10) August 10, 1975 (age 48)Baltimore, Maryland, U.S.Height:6 ft 3 in (1.91 m)Weight:311 lb (141 kg)Career informationHigh school:Essex (MD) ChesapeakeCollege:Saginaw Valley StateNFL D...

German bishop and historian (975–1018) For the German count, see Thietmar, Count of Merseburg. Thietmar of Merseburg in a Bas-relief by Karolin Donst, Tangermünde Thietmar (also Dietmar or Dithmar; 25 July 975 – 1 December 1018), Prince-Bishop of Merseburg from 1009 until his death in 1018, was an important chronicler recording the reigns of German kings and Holy Roman Emperors of the Ottonian (Saxon) dynasty. Two of Thietmar's great-grandfathers, both referred to as Liuthar...

Irish jockey Wayne LordanLordan on Sole Power after winning the 2010 NunthorpeOccupationJockeyBornCrossbarry, County CorkMajor racing winsBritish Classics 1,000 Guineas (2017) Other major British races British Champions Sprint Stakes (2013, 2014) Diamond Jubilee Stakes (2014) July Cup (2014) Nassau Stakes (2015) Nunthorpe Stakes (2010) Major Irish races Matron Stakes (2015, 2017)Significant horsesGordon Lord Byron, Slade Power, Sole Power, Winter Wayne Lordan is a multiple Group race winning ...