P2RX1

P2RX1
Ідентифікатори
Символи P2RX1, P2X1, purinergic receptor P2X 1
Зовнішні ІД OMIM: 600845 MGI: 1098235 HomoloGene: 1921 GeneCards: P2RX1
Реагує на сполуку
Аденозинтрифосфат[1]
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002558
NM_008771
RefSeq (білок)
NP_002549
NP_032797
Локус (UCSC) Хр. 17: 3.9 – 3.92 Mb Хр. 11: 72.89 – 72.91 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

P2RX1 (англ. Purinergic receptor P2X 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 399 амінокислот, а молекулярна маса — 44 980[5].

Послідовність амінокислот
1020304050
MARRFQEELAAFLFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFL
YEKGYQTSSGLISSVSVKLKGLAVTQLPGLGPQVWDVADYVFPAQGDNSF
VVMTNFIVTPKQTQGYCAEHPEGGICKEDSGCTPGKAKRKAQGIRTGKCV
AFNDTVKTCEIFGWCPVEVDDDIPRPALLREAENFTLFIKNSISFPRFKV
NRRNLVEEVNAAHMKTCLFHKTLHPLCPVFQLGYVVQESGQNFSTLAEKG
GVVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVEN
GTNYRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCD
LLLLHILPKRHYYKQKKFKYAEDMGPGAAERDLAATSSTLGLQENMRTS

Кодований геном білок за функціями належить до рецепторів, іонних каналів, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, транспорт іонів, транспорт. Локалізований у мембрані.

Література

  • Longhurst P.A., Schwegel T., Folander K., Swanson R. (1996). The human P2x1 receptor: molecular cloning, tissue distribution, and localization to chromosome 17. Biochim. Biophys. Acta. 1308: 185—188. PMID 8809107 DOI:10.1016/0167-4781(96)00112-1
  • Sun B., Li J., Okahara K., Kambayashi J. (1998). P2X1 purinoceptor in human platelets. Molecular cloning and functional characterization after heterologous expression. J. Biol. Chem. 273: 11544—11547. PMID 9565569 DOI:10.1074/jbc.273.19.11544
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Ennion S.J., Evans R.J. (2002). Conserved cysteine residues in the extracellular loop of the human P2X(1) receptor form disulfide bonds and are involved in receptor trafficking to the cell surface. Mol. Pharmacol. 61: 303—311. PMID 11809854 DOI:10.1124/mol.61.2.303
  • Roberts J.A., Bottrill A.R., Mistry S., Evans R.J. (2012). Mass spectrometry analysis of human P2X1 receptors; insight into phosphorylation, modelling and conformational changes. J. Neurochem. 123: 725—735. PMID 22971236 DOI:10.1111/jnc.12012

Примітки

  1. Сполуки, які фізично взаємодіють з Purinergic receptor P2X 1 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:8533 (англ.) . Процитовано 12 вересня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  5. UniProt, P51575 (англ.) . Архів оригіналу за 11 травня 2018. Процитовано 12 вересня 2017.

Див. також


Read other articles:

Halaman ini berisi artikel tentang Huruf dalam Alfabet Kiril. Untuk perusahaan elektronik, lihat Hollywood (chip grafis). Artikel ini membutuhkan rujukan tambahan agar kualitasnya dapat dipastikan. Mohon bantu kami mengembangkan artikel ini dengan cara menambahkan rujukan ke sumber tepercaya. Pernyataan tak bersumber bisa saja dipertentangkan dan dihapus.Cari sumber: Broad On – berita · surat kabar · buku · cendekiawan · JSTOR (Juni 2011) Huruf KirilBr...

 

Adel Taarabt Informasi pribadiNama lengkap Adel TaarabtTanggal lahir 24 Mei 1989 (umur 34)[1]Tempat lahir Fes, Maroko[2]Tinggi 1,80 m (5 ft 11 in)[1]Posisi bermain Gelandang serang / WingerInformasi klubKlub saat ini Genoa(pinjaman dari Benfica)Nomor 17Karier junior2004–2006 LensKarier senior*Tahun Tim Tampil (Gol)2006–2007 Lens 1 (0)2007 → Tottenham Hotspur (pinjaman) 2 (0)2007–2010 Tottenham Hotspur 7 (0)2009–2010 → Queens Park Ranger...

 

MongoDB TipeNoSQL, document-oriented database (en), Sistem manajemen basis data dan source-available software (en) Versi pertama2009; 15 tahun lalu (2009)Versi stabil 6.0.7 (28 Juni 2023) GenrePangkalan data berorientasi dokumenLisensiServer Side Public LicenseBahasaDaftar bahasa Inggris Karakteristik teknisSistem operasiWindows Vista dan yang lebih baru, Linux, OS X 10.7 dan yang lebih baru, Solaris,[1] FreeBSD[2]Bahasa pemrogramanC++, Go, Javascript, C dan Python Inform...

Giovanni Dettorivescovo della Chiesa cattolica Diligamus nos invicem  TitoloAles-Terralba Incarichi attualiVescovo emerito di Ales-Terralba (dal 2016) Incarichi ricopertiVescovo di Ales-Terralba (2004-2016)  Nato26 gennaio 1940 (84 anni) a Nule Ordinato presbitero1º luglio 1965 dal vescovo Francesco Cogoni Nominato vescovo5 febbraio 2004 da papa Giovanni Paolo II Consacrato vescovo18 aprile 2004 dal cardinale Mario Francesco Pompedda   Manuale Giovanni Dettori (Nule, 26 g...

 

City in Iowa, United StatesRiverdale, IowaCityWelcome sign along U.S. 67 .Location of Riverdale, IowaCoordinates: 41°32′8″N 90°28′2″W / 41.53556°N 90.46722°W / 41.53556; -90.46722CountryUnited StatesState IowaCountyScottIncorporatedDecember 27, 1950Government • TypeMayor-Council • MayorAnthony HeddlestenArea[1] • City2.21 sq mi (5.73 km2) • Land1.84 sq mi (4.76 km2)&...

 

Pour les articles homonymes, voir Herbert. James HerbertJames Herbert en 2012.BiographieNaissance 8 avril 1943Londres, Angleterre, Royaume-UniDécès 20 mars 2013 (à 69 ans)Sussex, Angleterre, Royaume-UniSépulture The Parish Church of St Peter (d)Nationalité britanniqueFormation Université du MiddlesexSt Aloysius College (en)Activité RomancierPériode d'activité à partir de 1974Autres informationsGenre artistique HorreurDistinctions Officier de l'ordre de l'Empire britanniqueWorl...

Americans of Vietnamese birth or descent Vietnamese AmericansNgười Mỹ gốc ViệtTotal population2,183,000[1]0.7% of the total U.S. population (2018)Regions with significant populationsLos Angeles and Orange CountySan Francisco Bay Area (esp. San Jose)Sacramento, CaliforniaGreater HoustonDallas-Fort WorthTwin Cities metropolitan areaWashington metropolitan area/Northern Virginia/MarylandSeattle areaSan Diego CountyMetro AtlantaGreater New OrleansGreater BostonPhiladelphia areaNe...

 

Television show season Season of television series The SopranosSeason 1Season 1 DVD cover artStarring James Gandolfini Lorraine Bracco Edie Falco Michael Imperioli Dominic Chianese Vincent Pastore Steven Van Zandt Tony Sirico Robert Iler Jamie-Lynn Sigler Nancy Marchand No. of episodes13ReleaseOriginal networkHBOOriginal releaseJanuary 10 (1999-01-10) –April 4, 1999 (1999-04-04)Season chronologyNext →Season 2List of episodes The first season of the American crime dram...

 

Stutthof Ingången till Stutthof.PlatsStutthof (dagens Sztutowo)I bruk2 september 1939 – 9 maj 1945KommendantMax PaulyPaul Werner HoppeGaskammareEn gaskammare samt gasvagnarAntal döda63 000–65 000Befriat avRöda armén den 9 maj 1945 Stutthof (polska Sztutowo) var det första koncentrationslägret som nazisterna lät uppföra i Tyskland utanför 1937 års landgräns (i den före detta Fria staden Danzig), beläget 34 kilometer från Danzig (polska Gdańsk). Historik I Stutthof...

American football coach (born 1976) Dave ArandaCurrent positionTitleHead coachTeamBaylorConferenceBig 12Record23–25Biographical detailsBorn (1976-09-29) September 29, 1976 (age 47)Kern County, California, U.S.Alma mater California Lutheran (BA) Texas Tech (MS) Coaching career (HC unless noted)1995Redlands HS (CA) (JV)1996–1999Cal Lutheran (LB)2000–2002Texas Tech (GA)2003–2004Houston (LB)2005–2006Cal Lutheran (DC/LB)2007Delta State (co-DC/LB)2008Southern Utah (DC)2008–200...

 

Hotel in Yanuca Island, FijiShangri-La Fijian ResortGeneral informationTypeHotelLocationYanuca IslandCountryFijiCurrent tenantsShangri-La Hotels and ResortsOpened1967 Main swimming pool Shangri-La's Fijian Resort is a luxury resort located at Yanuca Island, on Viti Levu island, Cuvu, Sigatoka, Fiji. Currently managed by Shangri-La Hotels and Resorts, the resort originally opened in 1967. After independence from the British, and going local was encouraged over expatriate management, Mr Andrew ...

 

Лаппо-Данилевський Олександр СергійовичНародився 15 (27) січня 1863Верхньодніпровський повіт, Катеринославська губернія, Російська імперіяПомер 7 лютого 1919(1919-02-07)[1] (56 років)Петроград, Російська СФРР[1]·сепсисПоховання Державний історико-меморіальний Лук'янівськи�...

Video game editing technique This article includes a list of general references, but it lacks sufficient corresponding inline citations. Please help to improve this article by introducing more precise citations. (July 2018) (Learn how and when to remove this message) ROM hacking, (also known as Read-only memory hacking), is the process of modifying a ROM image or ROM file of a video game to alter the game's graphics, dialogue, levels, gameplay, and/or other elements. This is usually done by t...

 

Act of leaving one's country or region to settle in another Not to be confused with Immigration or migration. Emigrant redirects here. For other uses, see The Emigrants (disambiguation). Emigrate redirects here. For the band, see Emigrate (band). For the 2007 album, see Emigrate (album). Emigration is the act of leaving a resident country or place of residence[1] with the intent to settle elsewhere (to permanently leave a country).[2] Conversely, immigration describes the move...

 

The Tiger HunterSutradaraLena KhanProduser Nazia Khan Lena Khan Megha Kadakia Ditulis oleh Lena Khan Sameer Gardezi Pemeran Danny Pudi Jon Heder Rizwan Manji Karen David Iqbal Theba Sam Page Parvesh Cheena Michael McMillian Kevin Pollak Penata musik Amy Correia Paul Masvidal SinematograferPatrice CochetPenyunting Dan Bush Jon Berry PerusahaanproduksiSneaky Sneaky FilmsTanggal rilis 21 April 2016 (2016-04-21) (LAAPFF) Durasi94 menitNegaraAmerika SerikatBahasaInggris The Tiger Hu...

Term used in nomenclature (naked name) The skull of Little Foot, sometimes referred to under the nomen nudum Australopithecus prometheus[1] In taxonomy, a nomen nudum ('naked name'; plural nomina nuda) is a designation[2] which looks exactly like a scientific name of an organism, and may have originally been intended to be one, but it has not been published with an adequate description. This makes it a bare or naked name, which cannot be accepted as it stands.[3] A la...

 

National Highway in India National Highway 965DDMap of National Highway 965DD in redRoute informationAuxiliary route of NH 65Length168 km (104 mi)Major junctionsWest endLonandEast endPacharal LocationCountryIndiaStatesMaharashtra Highway system Roads in India Expressways National State Asian ← NH 965D→ NH 965DD National Highway 965DD, commonly referred to as NH 965DD is a national highway in India.[1][2] It is a secondary route of primary National ...

 

Sergei Mikhailovich SheydemanBorn(1857-08-18)18 August 1857Died1922 (aged 64–65)AllegianceRussian EmpireRussian Soviet Federative Socialist RepublicService/branchImperial Russian ArmyRed ArmyRankGeneral of the CavalryCommands3rd Cavalry Division2nd Army Corps2nd ArmyBattles/wars Russo-Turkish War (1877–78) World War I Battle of Tannenberg Battle of Łódź (1914) Battle of the Vistula River Russian Civil War Sergei Mikhailovich Sheydeman (Russian: Сергей Михайлови�...

Roggia BorgognaNel centro storico di ScanzorosciateStato Italia Lunghezza18,5 km[1] Portata media4,3 m³/s Altitudine sorgente294 m s.l.m. NasceOpera di presa sul fiume Serio a Villa di Serio SfociaSerio presso Cavernago Modifica dati su Wikidata · Manuale La roggia Borgogna è un canale artificiale lungo circa 18 km, derivato dal fiume Serio, che percorre la provincia di Bergamo. Indice 1 Storia 2 La Borgogna-Pradalunga 2.1 La vasca di carico di Albino 2.2 Il tracciat...

 

Mexican politician María Leonor Noyola Cervantes (born April 25, 1962) is a Mexican politician affiliated with the Green Ecologist Party of Mexico. Since September 1, 2018, she is a senator of the republic in the LXIV Legislature of the Congress of the Union representing the state of San Luis Potosí.[1] Early years María Leonor Noyola Cervantes was born on April 25, 1962, in the state of San Luis Potosí, Mexico. She studied for a degree in public accounting. From 2012 to 2015 she ...