GABRA2

GABRA2
Ідентифікатори
Символи GABRA2, gamma-aminobutyric acid type A receptor alpha2 subunit
Зовнішні ІД OMIM: 137140 MGI: 95614 HomoloGene: 20217 GeneCards: GABRA2
Реагує на сполуку
gaboxadol, isonipecotic acid, isoguvacine, Мусцимол, ZK93423, flumazenil, ZK93426, bretazenil, L-822179, methyl 6,7-dimethoxy-4-ethyl-β-carboline-3-carboxylate, Ro-15-4513, RO4938581, L-838417, ocinaplon, алпразолам, клоназепам, діазепам, Флунітразепам, triazolam, золпідем, bicuculline, picrotoxin, CGS8216[1]
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
2555
14395
Ensembl
ENSG00000151834
н/д
UniProt
P47869
P26048
RefSeq (мРНК)
NM_000807
NM_001114175
NM_001286827
NM_001330690
NM_008066
RefSeq (білок)
NP_032092
Локус (UCSC) Хр. 4: 46.25 – 46.48 Mb н/д
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

GABRA2 (англ. Gamma-aminobutyric acid type A receptor alpha2 subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 451 амінокислот, а молекулярна маса — 51 326[5].

Послідовність амінокислот
1020304050
MKTKLNIYNMQFLLFVFLVWDPARLVLANIQEDEAKNNITIFTRILDRLL
DGYDNRLRPGLGDSITEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKWKDE
RLKFKGPMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIQD
DGTLLYTMRLTVQAECPMHLEDFPMDAHSCPLKFGSYAYTTSEVTYIWTY
NASDSVQVAPDGSRLNQYDLLGQSIGKETIKSSTGEYTVMTAHFHLKRKI
GYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA
RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSVV
NDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKP
ENKPAEAKKTFNSVSKIDRMSRIVFPVLFGTFNLVYWATYLNREPVLGVS
P

Кодований геном білок за функціями належить до рецепторів, іонних каналів, хлорних каналів. Задіяний у таких біологічних процесах як транспорт іонів, транспорт, альтернативний сплайсинг. Білок має сайт для зв'язування з хлоридом. Локалізований у клітинній мембрані, мембрані, клітинних контактах, цитоплазматичних везикулах, синапсах.

Література

Примітки

  1. ↑ Сполуки, які фізично взаємодіють з Gamma-aminobutyric acid type A receptor subunit alpha2 переглянути/редагувати посилання на ВікіДаних.
  2. ↑ Human PubMed Reference:.
  3. ↑ Mouse PubMed Reference:.
  4. ↑ HUGO Gene Nomenclature Commitee, HGNC:4076 (англ.) . Процитовано 30 серпня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  5. ↑ UniProt, P47869 (англ.) . Архів оригіналу за 16 вересня 2017. Процитовано 30 серпня 2017.

Див. також

Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

Read other articles:

Dunia Bawah Sumeria Kuno

Gambar pada cetakan segel silinder Sumeria Kuno yang menunjukkan dewa Dumuzid sedang disiksa di dunia bawah oleh setan galla Dunia Bawah Sumeria Kuno, dalam bahasa Sumeria dikenal sebagai Kur, Irkalla, Kukku, Arali, atau Kigal dan dalam bahasa Akkadia disebut Erṣetu, meskipun memiliki banyak nama dalam kedua bahasa tersebut, tempat yang dimaksud merupakan sebuah gua yang gelap dan suram yang terletak jauh di bawah tanah,[1][2] penduduknya diyakini melanjutkan versi kehidupan...

 

 

The Summoner's Tale

Part of the Canterbury Tales The Summoner's Tale is one of The Canterbury Tales by Geoffrey Chaucer. The tale is a fierce counterpunch to the preceding tale by The Friar, who had delivered an attack on summoners. Summoners were officials in ecclesiastical courts who delivered a summons to people who had been brought up on various charges;[1] the office was prone to corruption, since summoners were infamous for threatening to bring people up on charges unless they were bought off. The ...

 

 

Ba–Shu culture

Culture of Sichuan and nearby parts of China Pattern of the Golden Sun Bird discovered at Jinsha site, a symbol of the Ba–Shu culture and believed to be a totem of the ancient Shu people.[1] It has been designated a symbol for the Chinese culture as a whole by the Chinese government.Ba-Shu culture (Chinese: 巴蜀文化; pinyin: Bāshǔ wénhuà) refers to a regional culture centered around Sichuan province and Chongqing city, also encompassing parts of Yunnan, Guizhou and ...

Brunei at the Olympics

Sporting event delegationBrunei at theOlympicsIOC codeBRUNOCBrunei Darussalam National Olympic CouncilWebsitewww.bruneiolympic.orgMedals Gold 0 Silver 0 Bronze 0 Total 0 Summer appearances1988199219962000200420082012201620202024 Brunei, as Brunei Darussalam, first participated at the Olympic Games in 1988, with a single official but no athletes. The nation returned and sent athletes to compete in the Summer Olympic Games in 1996, 2000 and 2004. On each occasion, it was represented by a single...

 

 

Nakawa Division

Nakawa Division is one of the five administrative divisions of the city of Kampala, the capital and largest city of Uganda. The town of Nakawa is the site of the division headquarters. Location Nakawa Division lies in the eastern part of the city, bordering Kira Town to the east, Wakiso District to the north, Kawempe Division to the north-west, Kampala Central Division to the west, Makindye Division across Murchison Bay to the south-west and Lake Victoria to the south.[1] The coordina...

 

 

Hydrocodone/paracetamol

Combination pain relief drug Adol redirects here. Not to be confused with protagonist of the Ys video game series. Hydrocodone/paracetamolCombination ofHydrocodoneOpioid analgesicParacetamolAnilide analgesicClinical dataTrade namesLorcet, Norco, Vicodin, othersOther namesHydrocodone/acetaminophen, hydrocodone/APAPAHFS/Drugs.comProfessional Drug FactsLicense data US DailyMed: Hydrocodone bitartrate and acetaminophen Routes ofadministrationBy mouthATC codeN02AJ22 (WHO) Legal...

Shinji Sogō

Shinji SogōSogo Shinji (十河信二, 1884 – 1981)Nama asal十河 信二Lahir(1884-04-14)14 April 1884Niihama, Ehime, JepangMeninggal3 Oktober 1981(1981-10-03) (umur 97)Tokyo, JepangPekerjaan Birokrat Japanese National Railways Kepala Japanese National Railways Shinji Sogō (十河 信二,code: ja is deprecated , Sogō Shinji, 14 April 1884 – 3 Oktober 1981) adalah kepala Japan National Railway keempat dan dikenal atas kontribusinya dalam proyek pembangunan bullet train atau k...

 

 

Paris-Nice 2018

Cet article est une ébauche concernant le cyclisme. Vous pouvez partager vos connaissances en l’améliorant (comment ?) selon les recommandations des projets correspondants. Paris-Nice 2018 passage du peloton à Apt, lors de la 5ème étapeGénéralitésCourse76e Paris-NiceCompétitionUCI World Tour 2018 2.UWTÉtapes8Dates4 – 11 mars 2018Distance1 198,9 kmPays FranceLieu de départChatouLieu d'arrivéeNiceÉquipes22Partants154Arrivants78Vitesse moyenne39,463 km/hSite officielS...

 

 

Scrapple

ScrappleSepiring scrappleNama lainPon haus, KrepplesJenisMushTempat asalUnited StatesDaerahPennsylvaniaBahan utamamush of pork, cornmeal, flour, buckwheat flour, spicesEnergi makanan(per porsi )119 per 2 ounces kkalSunting kotak info • L • BBantuan penggunaan templat ini Scrapple atau nama lainnya pon haus atau pan rabbit adalah semacam lumatan dari sisa-sisa potongan daging babi, seperti kepala, otak, hati, dan kulit, dipadu dengan tepung jagung dan gandum. Lumatan ini kem...

Marga, Tabanan

Untuk tempat lain yang bernama sama, lihat Marga (disambiguasi). Koordinat: 8°31′21.45″S 115°10′15.78″E / 8.5226250°S 115.1710500°E / -8.5226250; 115.1710500 MargaKecamatanPeta lokasi Kecamatan MargaNegara IndonesiaProvinsiBaliKabupatenTabananPemerintahan • CamatDrs. I Gst Agung Alit Adiatmika[1]Populasi • Total44,768 jiwa (2.016)[2] 40,353 jiwa (2.010)[3] jiwaKode pos82181Kode Kemendagri51.02.07 Kode BPS...

 

 

Nexus S

Nexus SNexus SMerekGoogle / SamsungPembuatSamsungSeriGoogle NexusOperatorAustralia Vodafone, 3, Optus, TelstraAS T-Mobile USA, Sprint, AT&T, NTT Docomo USA Britania Raya O2 UK, Orange UK, T-Mobile UK, Vodafone UK, 3Kanada Rogers, Fido Solutions, WIND Mobile, Mobilicity, Videotron, Telus, Koodo Mobile[1]Korea Selatan KT, SKTJaringanGSM/GPRS/EDGE Quad-band (850, 900, 1800, dan 1900 MHz) AWS WCDMA/HSPA Tri-band (900, 1700, dan 2100 MHz) atau UMTS WCDMA/HSPA Tri-band (850, 1...

 

 

Cresap's War

Border conflict between the British colonies of Pennsylvania and Maryland (1730–67) For the 1774 conflict also known as Cresap's War, see Lord Dunmore's War. Cresap's WarMap showing the area disputed between Maryland and Pennsylvania during Cresap's WarDate1730–1767LocationPennsylvania–Maryland borderResult Military stalemate Establishment of the Mason–Dixon lineBelligerents Colony of Pennsylvania Colony of MarylandCommanders and leaders Patrick Gordon John the American Penn Samuel Sm...

Saint-Vincent-et-les-Grenadines

Pour les articles homonymes, voir Saint-Vincent, Grenadines et SVG. Saint-Vincent-et-les-Grenadines(en) Saint Vincent and the Grenadines Drapeau de Saint-Vincent-et-les-Grenadines Armoiries de Saint-Vincent-et-les-Grenadines Devise en latin : Pax et justitia (« Paix et justice ») Hymne en anglais : Saint Vincent Land So Beautiful (« Saint Vincent, terre si belle ») Fête nationale 27 octobre · Événement commémoré Indépendance v...

 

 

Drupada

Ruler of Panchala Kingdom This article is about a mythological character. For a form of Indian classical music, see Dhrupad. Fictional character DrupadaInformationWeaponGada, Bow and ArrowFamilyPrishata (father) Suchitra (brother)SpousePrishatiChildrenDhrishtadyumna, Shikhandi, Satyajita, Uttamaujas, Yudhamanyu and other sonsDraupadi (daughter) Drupada (Sanskrit: द्रुपद, lit. 'firm footed or pillar'[1]), also known as Yajnasena (Sanskrit: यज्ञसे�...

 

 

2022 Oakland mayoral election

2022 Oakland mayoral election ← 2018 November 8, 2022 (2022-11-08) 2026 → Turnout53.28%   Candidate Sheng Thao Loren Taylor Ignacio De La Fuente First round 39,90931.8% 41,51033.1% 12,89310.3% Final round 57,20650.3% 56,52949.7% Eliminated   Candidate Allyssa Victory Treva Reid First round 10,9498.7% 7,6276.1% Final round Eliminated Eliminated Mayor before election Libby Schaaf Elected Mayor Sheng Thao Elections in California Federal government ...

Energy in Iraq

Total energy supply 2021[1]   Oil (61.93%)  Natural gas (35.51%)  Hydro (0.92%)  Biofuels and Waste (0.12%)  Wind, Solar, etc. (0.01%) Energy in Iraq plays a crucial role in both the national economy and the global energy markets due to the country's vast oil reserves and significant status within the Organization of the Petroleum Exporting Countries (OPEC). [2] Iraq holds abundant oil and gas resources and has strong solar PV...

 

 

President of the Philippines

Head of state and head of government of the Philippines For the list, see List of presidents of the Philippines. President of the PhilippinesPangulo ng PilipinasPresidential sealPresidential flagIncumbentBongbong Marcossince June 30, 2022Government of the PhilippinesOffice of the PresidentStyle Mr. President(informal) The Honorable(formal) His Excellency(diplomatic) TypeHead of state Head of government Commander-in-chiefMember ofCabinetNational Security CouncilResidenceMalacañang Palace...

 

 

بنطال الجرس

بنطال الجرسمعلوماتالنوع بنطالتعديل - تعديل مصدري - تعديل ويكي بيانات لباس البحارة في سنة 1854. بنطال الجَرَس أو البنطال الواسع هو بنطال يبدأ في الاتساع من الركبة حتى الأسفل. الأصل لا يوجد تاريخ مؤكد حول زمن لبس هذا البنطال للمرة الأولى. في بدايات القرن التاسع عشر بدأ أفراد سلا...

Hubungan Filipina dengan Malaysia

Hubungan Malaysia–Filipina Malaysia Filipina Hubungan Malaysia–Filipina (Filipina: Ugnayang Malaysia–Pilipinas) merujuk kepada hubungan luar negeri antara Malaysia dan Filipina. Filipina memiliki sebuah kedubes di Kuala Lumpur, dan Malaysia memiliki sebuah kedubes di Manila dan sebuah konjen di Kota Davao. Rakyat dari dua negara tetangga tersebut memiliki sejarah hubungan kebudayaan dan politik yang panjang.[1] Mereka sama-sama merupakan anggota pendiri ASEAN, kedua negara ters...

 

 

Schelda

ScheldaLa Schelda a PecqStati Francia Belgio Paesi Bassi Lunghezza350 km Portata media120 m³/s Bacino idrografico21 860 km² Altitudine sorgente95 m s.l.m. NasceGouy SfociaMare del Nord Modifica dati su Wikidata · Manuale La Schelda[1][2] (in olandese Schelde; in francese Escaut) è un fiume lungo 350 km la cui sorgente è nel nord della Francia. Tocca le città di Cambrai e Valenciennes, entra in Belgio, attraversa le città di Tournai, Oudenaa...