CHRNB4

CHRNB4
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CHRNB4, cholinergic receptor nicotinic beta 4 subunit
Зовнішні ІД OMIM: 118509 MGI: 87892 HomoloGene: 20196 GeneCards: CHRNB4
Реагує на сполуку
larazotide acetate[1]
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000750
NM_001256567
NM_148944
RefSeq (білок)
NP_000741
NP_001243496
NP_683746
Локус (UCSC) Хр. 15: 78.62 – 78.73 Mb Хр. 9: 54.94 – 54.96 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CHRNB4 (англ. Cholinergic receptor nicotinic beta 4 subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 498 амінокислот, а молекулярна маса — 56 380[5].

Послідовність амінокислот
1020304050
MRRAPSLVLFFLVALCGRGNCRVANAEEKLMDDLLNKTRYNNLIRPATSS
SQLISIKLQLSLAQLISVNEREQIMTTNVWLKQEWTDYRLTWNSSRYEGV
NILRIPAKRIWLPDIVLYNNADGTYEVSVYTNLIVRSNGSVLWLPPAIYK
SACKIEVKYFPFDQQNCTLKFRSWTYDHTEIDMVLMTPTASMDDFTPSGE
WDIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLIIPCVLTTLLA
ILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDVPLIGKYLM
FTMVLVTFSIVTSVCVLNVHHRSPSTHTMAPWVKRCFLHKLPTFLFMKRP
GPDSSPARAFPPSKSCVTKPEATATSTSPSNFYGNSMYFVNPASAASKSP
AGSTPVAIPRDFWLRSSGRFRQDVQEALEGVSFIAQHMKNDDEDQSVVED
WKYVAMVVDRLFLWVFMFVCVLGTVGLFLPPLFQTHAASEGPYAAQRD

Кодований геном білок за функціями належить до рецепторів, іонних каналів. Задіяний у таких біологічних процесах, як транспорт іонів, транспорт, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані, клітинних контактах, синапсах.

Література

  • Groot Kormelink P.J., Luyten W.H.M.L. (1997). Cloning and sequence of full-length cDNAs encoding the human neuronal nicotinic acetylcholine receptor (nAChR) subunits beta3 and beta4 and expression of seven nAChR subunits in the human neuroblastoma cell line SH-SY5Y and/or IMR-32. FEBS Lett. 400: 309—314.  PMID 9009220 DOI:10.1016/S0014-5793(96)01383-X
  • Lev-Lehman E., Bercovich D., Xu W., Stockton D.W., Beaudet A.L. (2001). Characterization of the human beta4 nAChR gene and polymorphisms in CHRNA3 and CHRNB4. J. Hum. Genet. 46: 362—366.  PMID 11450844 DOI:10.1007/s100380170054
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004.  PMID 15489334 DOI:10.1101/gr.2596504
  • Gerzanich V., Kuryatov A., Anand R., Lindstrom J. (1997). 'Orphan' alpha6 nicotinic AChR subunit can form a functional heteromeric acetylcholine receptor. Mol. Pharmacol. 51: 320—327.  PMID 9203638

Примітки

Див. також

Read other articles:

HawaiʻiPulau BesarLandsat mosaic, 1999–2001.Lokasi di negara Hawaii.GeografiLokasi19°34′N 155°30′W / 19.567°N 155.500°W / 19.567; -155.500Wilayah4,028.0 sq. mi. (10,432.5 km²)Peringkatke-1, Pulau Hawaii terbesarTitik tertinggiMauna KeaPeninggian maksimum13,796 ft. (4,205 m)DemografiJumlah penduduk148,677 (pada 2000)Kepadatan37/sq mi (14/km²)Official InsigniaBungaʻŌhiʻa lehuaWarnaʻUlaʻula (red) Pulau Hawaii,[1] juga...

 

Buku Harian BaimGenre Drama Keluarga PembuatRapi FilmsSutradaraUmam A.PPemeran Ibrahim Al Katiri Raffi Ahmad Nina Zatulini Inneke Koesherawati Nizam Christable Nadya Almira Penggubah lagu temaMelly GoeslawLagu pembukaCatatanku — Melly Goeslaw feat. BaimLagu penutupCatatanku — Melly Goeslaw feat. BaimPenata musikJaya M. S.Negara asalIndonesiaBahasa asliBahasa IndonesiaJmlh. musim1Jmlh. episode95 (daftar episode)ProduksiProduser Gope T. Samtani Sunil Samtani Pengaturan kameraTurpin S...

 

Former municipality in Norway Former municipality in Nord-Trøndelag, NorwayVemundvik Municipality Vemundvik herredFormer municipalityNord-Trøndelag within NorwayVemundvik within Nord-TrøndelagCoordinates: 64°31′03″N 11°32′31″E / 64.51750°N 11.54194°E / 64.51750; 11.54194CountryNorwayCountyNord-TrøndelagDistrictNamdalenEstablished1 Jan 1838 • Created asFormannskapsdistriktDisestablished1 Jan 1964 • Succeeded byNamsos MunicipalityA...

Langouet L'église Saint-Armel. Administration Pays France Région Bretagne Département Ille-et-Vilaine Arrondissement Rennes Intercommunalité Communauté de communes du Val d'Ille-Aubigné Maire Mandat Jean-Luc Dubois 2020-2026 Code postal 35630 Code commune 35146 Démographie Gentilé Langouëtiens Populationmunicipale 617 hab. (2021 ) Densité 88 hab./km2 Population agglomération 18 579 hab. Géographie Coordonnées 48° 14′ 59″ nord, 1° 49�...

 

Peshwa of the Maratha Empire Balaji VishwanathPortrait of Balaji Vishwanath at the Peshwa Memorial in Parvati Hill, Pune 6th Peshwa of the Maratha EmpireIn officeNovember 16, 1713 – April 02, 1720MonarchShahu IPreceded byParshuram Pant PratinidhiSucceeded byBaji Rao I Personal detailsBorn(1662-01-01)1 January 1662Shrivardhan, Bijapur Sultanate (modern day Maharashtra, India)Died12 April 1720(1720-04-12) (aged 58)Saswad, Maratha Confederacy(modern day Maharashtra, India)Spouse(...

 

Disambiguazione – Passat rimanda qui. Se stai cercando altri significati, vedi Passat (disambigua). La neutralità di questa voce o sezione sull'argomento automobili è stata messa in dubbio. Motivo: da rivedere totalmente, la forma è più adatta a un dépliant Per contribuire, correggi i toni enfatici o di parte e partecipa alla discussione. Non rimuovere questo avviso finché la disputa non è risolta. Segui i suggerimenti del progetto di riferimento. Volkswagen Passat Desc...

Esports tournament ESL One Katowice 20152015The ESL One Katowice 2015 logoTournament informationSportCounter-Strike: Global OffensiveLocationKatowice, Silesian Voivodeship, PolandDatesMarch 12, 2015–March 15, 2015AdministratorValve ESLTournamentformat(s)16 team GSL group stageEight team single-elimination playoffVenueSpodek ArenaTeams16 teamsPurse$250,000 USDFinal positionsChampionsFnatic (2nd title)1st runners-upNinjas in Pyjamas2nd runners-upTeam EnVyUs Virtus.proMVPOlof olofmeister Kajbj...

 

New Zealand cyclist Timothy GudsellPersonal informationFull nameTimothy GudsellBorn (1984-02-17) 17 February 1984 (age 40)Feilding, New ZealandHeight187 cm (6 ft 2 in)Weight77 kg (170 lb)Team informationCurrent teamRetiredDisciplineRoad and TrackRoleRiderAmateur teams2006Albi Vélo Sport2006Française des Jeux (Stagiaire) Professional teams2007–2010Française des Jeux[1]2011PureBlack Racing Timothy Gudsell (born 17 February 1984) is a reti...

 

Військово-музичне управління Збройних сил України Тип військове формуванняЗасновано 1992Країна  Україна Емблема управління Військово-музичне управління Збройних сил України — структурний підрозділ Генерального штабу Збройних сил України призначений для планува...

French nun and Catholic saint Saint Julie redirects here. For other uses, see Saint Julie (disambiguation). SaintJulie BilliartSNDdeNSaint Julie Billiart painted in 1830, by an unknown artistBorn(1751-07-12)12 July 1751Cuvilly, Picardy, FranceDied8 April 1816(1816-04-08) (aged 64)Namur, BelgiumVenerated inRoman Catholic ChurchBeatified13 May 1906 by Pope Pius XCanonized22 June 1969 by Pope Paul VIFeast8 AprilPatronageeducators, teachers Julie Billiart, SNDdeN (12 July 1751 – 8 Apr...

 

August 1917 fire in Kazan, Russian Empire 1917 Kazan Gunpowder Plant fireDateAugust 14–24, 1917 (1917-08-14 – 1917-08-24)LocationKazanTypeFireCauseA negligent guard's cigar stubDeaths21Non-fatal injuries172Property damage542 buildings The 1917 Kazan Gunpowder Plant fire began on 14 August 1917 in the city of Kazan, which was then center of governorate within the Russian Empire, destroying the plant and spreading panic in the city on 14–16 August, which lasted at ...

 

18th-century war This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Persian expedition of 1796 – news · newspapers · books · scholar · JSTOR (November 2019) (Learn how and when to remove this message) Russo-Persian War of 1796Part of Russo-Persian WarsOath of allegiance of the Novoshemakhan Gasim khan to Russia...

Emilie Bach Emilie Bach (July 2, 1840 – April 29, 1890) (née Kohn) was an artist and journalist. In 1873, she co-founded the Imperial and Royal Vocational School of Art Embroidery [1] with fellow needleworker Therese Mirani in Vienna, Austria,[1][2] where she also filled the role of director.[3] She also established schools in Graz, Laibach, Prague, Brünn, and Agram.[2] She published several works on the subject of embroidery, including Muster Stilvoller Ha...

 

يفتقر محتوى هذه المقالة إلى الاستشهاد بمصادر. فضلاً، ساهم في تطوير هذه المقالة من خلال إضافة مصادر موثوق بها. أي معلومات غير موثقة يمكن التشكيك بها وإزالتها. (نوفمبر 2019) كأس الكؤوس الإفريقية 1997 تفاصيل الموسم كأس الكؤوس الإفريقية  النسخة 23  المنظم الاتحاد الإفريقي لكرة ...

 

Julie HagertyHagerty tahun 2019LahirJulie Beth Hagerty[1]15 Juni 1955 (umur 69)Cincinnati, Ohio, A.S.PekerjaanAktrisTahun aktif1979–sekarangPartai politikDemokratSuami/istriPeter Burki ​ ​(m. 1986; c. 1991)​ Richard Kagan ​(m. 1999)​ Julie Beth Hagerty (lahir 15 Juni 1955) adalah aktris dan mantan model Amerika Serikat. Ia memerankan Elaine dalam film Airplane! (1980) dan Airplane II: The Sequel ...

Cet article est une ébauche concernant un coureur cycliste hongkongais. Vous pouvez partager vos connaissances en l’améliorant (comment ?). Pour plus d’informations, voyez le projet cyclisme. Dans ce nom, le nom de famille, Ng, précède le nom personnel. Ng Pak-hangInformationsNaissance 22 février 1999 (25 ans)Nationalité hongkongaiseÉquipe actuelle HKSI Pro Cycling TeamÉquipe UCI 8.2018-HKSI Pro Cycling TeamPrincipales victoires Champion de Hong Kong sur route (2023)mod...

 

Disambiguazione – Se stai cercando il singolo dei Duck Sauce, vedi Barbra Streisand (singolo). Questa voce o sezione sugli argomenti attori statunitensi e cantanti statunitensi non cita le fonti necessarie o quelle presenti sono insufficienti. Puoi migliorare questa voce aggiungendo citazioni da fonti attendibili secondo le linee guida sull'uso delle fonti. Segui i suggerimenti dei progetti di riferimento 1, 2. Barbra StreisandBarbra Streisand nel 2018 Nazionalità Stati Unit...

 

Change of sound over time Sustain redirects here. For other uses, see Sustain (disambiguation). In sound and music, an envelope describes how a sound changes over time. For example, a piano key, when struck and held, creates a near-immediate initial sound which gradually decreases in volume to zero. An envelope may relate to elements such as amplitude (volume), frequency (with the use of filters) or pitch. Envelope generators, which allow users to control the different stages of a sound, are ...

جائحة فيروس كورونا في كولومبيا 2020   المرض مرض فيروس كورونا 2019 السلالة فيروس كورونا المرتبط بالمتلازمة التنفسية الحادة الشديدة النوع 2 التواريخ 31 يناير 2020(4 سنوات، و8 شهور، و3 أيام) المنشأ ووهان، خوبي، الصين المكان السويد  تعديل مصدري - تعديل   جزء من سلسلة م...

 

Unlawful killing of another human by criminally negligent or murderous operation of a vehicle For terrorist attacks, see Vehicle-ramming attack. The examples and perspective in this article may not represent a worldwide view of the subject. You may improve this article, discuss the issue on the talk page, or create a new article, as appropriate. (April 2012) (Learn how and when to remove this message) Part of a series onHomicide Murder Note: Varies by jurisdiction Assassination Attempted murd...