GRIN1

GRIN1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GRIN1, GluN1, MRD8, NMDA1, NMDAR1, NR1, NMD-R1, glutamate ionotropic receptor NMDA type subunit 1, NDHMSR, NDHMSD, DEE101
Зовнішні ІД OMIM: 138249 MGI: 95819 HomoloGene: 7187 GeneCards: GRIN1
Пов'язані генетичні захворювання
autosomal dominant non-syndromic intellectual disability 8[1]
Реагує на сполуку
Гліцин, Аспарагінова кислота, Tetrazolylglycine, N-метил-D-аспартат, homoquinolinic acid, 5,7-dichlorokynurenic acid, lanicemine, CERC-301, neboglamine, priralfinamide, esketamine, кетамін, cns-5161, ketamine hydrochloride, amantadine hydrochloride, orphenadrine citrate[2]
Шаблон експресії




Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000832
NM_001185090
NM_001185091
NM_007327
NM_021569
RefSeq (білок)
NP_000823
NP_001172019
NP_001172020
NP_015566
NP_067544
Локус (UCSC) Хр. 9: 137.14 – 137.17 Mb Хр. 2: 25.18 – 25.21 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

GRIN1 (англ. Glutamate ionotropic receptor NMDA type subunit 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[5] Довжина поліпептидного ланцюга білка становить 938 амінокислот, а молекулярна маса — 105 373[6].

Послідовність амінокислот
1020304050
MSTMRLLTLALLFSCSVARAACDPKIVNIGAVLSTRKHEQMFREAVNQAN
KRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPND
HFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSV
WFEMMRVYSWNHIILLVSDDHEGRAAQKRLETLLEERESKAEKVLQFDPG
TKNVTALLMEAKELEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVG
EREISGNALRYAPDGILGLQLINGKNESAHISDAVGVVAQAVHELLEKEN
ITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFAN
YSIMNLQNRKLVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLKI
VTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHT
VPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNG
MMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRST
LDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDA
LTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTAN
LAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELS
TMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTG
ELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDS
RSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQL
AFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDT
STGGGRGALQNQKDTVLPRRAIEREEGQLQLCSRHRES

Кодований геном білок за функціями належить до рецепторів, іонних каналів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транспорт іонів, транспорт, альтернативний сплайсинг. Білок має сайт для зв'язування з іоном кальцію, іоном магнію. Локалізований у клітинній мембрані, мембрані, клітинних контактах, синапсах.

Література

  • Foldes R.L., Rampersad V., Kamboj R.K. (1993). Cloning and sequence analysis of cDNAs encoding human hippocampus N-methyl-D-aspartate receptor subunits: evidence for alternative RNA splicing. Gene. 131: 293—298.  PMID 8406025 DOI:10.1016/0378-1119(93)90309-Q
  • Planells-Cases R., Sun W., Ferrer-Montiel A.V., Montal M. (1993). Molecular cloning, functional expression, and pharmacological characterization of an N-methyl-D-aspartate receptor subunit from human brain. Proc. Natl. Acad. Sci. U.S.A. 90: 5057—5061.  PMID 7685113 DOI:10.1073/pnas.90.11.5057
  • Zimmer M., Fink T.M., Franke Y., Lichter P., Spiess J. (1995). Cloning and structure of the gene encoding the human N-methyl-D-aspartate receptor (NMDAR1). Gene. 159: 219—223.  PMID 7622053 DOI:10.1016/0378-1119(95)00044-7
  • Foldes R.L., Rampersad V., Kamboj R.K. (1994). Cloning and sequence analysis of additional splice variants encoding human N-methyl-D-aspartate receptor (hNR1) subunits. Gene. 147: 303—304.  PMID 7926821 DOI:10.1016/0378-1119(94)90089-2
  • Tingley W.G., Roche K.W., Thompson A.K., Huganir R.L. (1993). Regulation of NMDA receptor phosphorylation by alternative splicing of the C-terminal domain. Nature. 364: 70—73.  PMID 8316301 DOI:10.1038/364070a0
  • Papadakis M., Hawkins L.M., Stephenson F.A. (2004). Appropriate NR1-NR1 disulfide-linked homodimer formation is requisite for efficient expression of functional, cell surface N-methyl-D-aspartate NR1/NR2 receptors. J. Biol. Chem. 279: 14703—14712.  PMID 14732708 DOI:10.1074/jbc.M313446200

Примітки

Див. також

Read other articles:

Artikel ini sebatang kara, artinya tidak ada artikel lain yang memiliki pranala balik ke halaman ini.Bantulah menambah pranala ke artikel ini dari artikel yang berhubungan atau coba peralatan pencari pranala.Tag ini diberikan pada November 2022. Ido DrentLahir27 January 1987 (1987-01-27) (usia 37)Pretoria, Afrika SelatanPekerjaanAktorTahun aktif2008–sekarangSuami/istriMandy Hodges (m. 2011–sekarang) Ido Drent (lahir 27 Januari 1987) adalah pemeran kelahiran Afrika Selatan yang s...

 

Hari Orang Muda Sedunia 2027LokasiSeoul  Korea SelatanJenisFestival pemudaPenyelenggaraGereja Katolik RomaPeserta/Pihak terlibat(diharapkan) Paus FransiskusSebelumnya2023 Portugal Hari Orang Muda Sedunia 2027 adalah festival pemuda Katolik internasional yang akan diadakan di Seoul, Korea Selatan. Festival ini diumumkan pada Misa penutupan Hari Orang Muda Sedunia 2023 di Lisbon, Portugal, oleh Bapa Suci Paus Fransiskus. Hari Orang Muda Sedunia 2027 di Seoul akan menjadi perayaan Hari Oran...

 

Basilika Tempat Ziarah Bunda Maria Penolong Umat KristianiBasilika Minor Tempat Ziarah Bunda Maria Penolong Umat KristianiSpanyol: Basílica de María AuxiliadoraBasilika Tempat Ziarah Bunda Maria Penolong Umat KristianiLokasiLimaNegara PeruDenominasiGereja Katolik RomaArsitekturStatusBasilika minorStatus fungsionalAktifAdministrasiKeuskupan AgungKeuskupan Agung Lima Basilika Tempat Ziarah Bunda Maria Penolong Umat Kristiani (Spanyol: Basílica de María Auxiliadora) adalah sebua...

Capital city of England and the United Kingdom This article is about the capital city of England and the United Kingdom. For other uses, see London (disambiguation). Capital city in EnglandLondonCapital cityRiver Thames and Tower Bridge with The Shard and Southwark (left), Tower of London and City of London (right)London EyeNelson's ColumnSt Paul'sPiccadilly CircusCanary WharfPalace of Westminster with Big Ben (right)LondonLocation within the United KingdomShow map of the United KingdomLondon...

 

Academy Awards ke-83Tanggal27 Februari 2011 (2011-02-27)TempatKodak TheatreHollywood, Los Angeles, CaliforniaPembawa acaraJames FrancoAnne Hathaway[1]Pembawa pra-acaraTim GunnMaria MenounosRobin RobertsKrista Smith[2]ProduserBruce CohenDon Mischer[3]Pengarah acaraDon Mischer[3]SorotanFilm TerbaikThe King's SpeechPenghargaan terbanyakInception dan The King's Speech (4)Nominasi terbanyakThe King's Speech (12)Liputan televisiJaringanABCDurasi3 jam, 16 menit&#...

 

Questa voce sull'argomento stagioni delle società calcistiche italiane è solo un abbozzo. Contribuisci a migliorarla secondo le convenzioni di Wikipedia. Segui i suggerimenti del progetto di riferimento. Voce principale: Crotone Calcio. Unione Sportiva CrotoneStagione 1951-1952Sport calcio Squadra Crotone Allenatore Mario Andreis Presidente Silvio Messinetti Serie C10º posto nel girone D. Retrocesso in IV Serie. 1950-1951 1952-1953 Si invita a seguire il modello di voce Questa p...

For the AM station, see WJMX (AM). WDAR redirects here. For the court, see United States District Court for the Western District of Arkansas. Radio station in Darlington, South CarolinaWDAR-FMDarlington, South CarolinaBroadcast areaFlorence, South CarolinaFrequency105.5 MHzBranding105.5 The BeatProgrammingFormatMainstream urbanOwnershipOwneriHeartMedia, Inc.(iHM Licenses, LLC)Sister stationsWDSC, WEGX, WJMX, WJMX-FM, WRZE, WWRK, WZTFHistoryFirst air dateMarch 1966; 58 years ...

 

Beef steak cut from the rear of a cow A rump steak being cooked on a griddle pan Part of a series onSteak Main articles Steak Beefsteak Fish steak Pork steak Steakhouse List of steak dishes Asado Beef Manhattan Beef Wellington Bife a cavalo Bistecca alla fiorentina Boiled beef Bulgogi Carpetbag steak Carne asada Chateaubriand steak Cheesesteak Chicken fried steak Bistek Tagalog Bollito misto Delmonico steak Fajita Finger steaks Hamburg steak London broil Mongolian beef Pepper steak Pot roast ...

 

Former stadium of Atlético Madrid in Madrid, Spain Estadio Vicente CalderónUEFA Full nameEstadio Vicente CalderónFormer namesEstadio Manzanares(1966–71)LocationArganzuela, Madrid, SpainCoordinates40°24′6.19″N 3°43′14.18″W / 40.4017194°N 3.7206056°W / 40.4017194; -3.7206056Capacity62 000[1]Field size105 m × 70 m (115 yd × 77 yd)ConstructionBroke ground3 August 1959; 64 years ago (1959-08-03)Opene...

† Египтопитек Реконструкция внешнего вида египтопитека Научная классификация Домен:ЭукариотыЦарство:ЖивотныеПодцарство:ЭуметазоиБез ранга:Двусторонне-симметричныеБез ранга:ВторичноротыеТип:ХордовыеПодтип:ПозвоночныеИнфратип:ЧелюстноротыеНадкласс:Четвероно...

 

Persian writer Fazlallah AstarabadiPersonalBorn1339 or 40Astarabad (present-day Gorgan)Died1394 (aged 53-55)NakhchivanReligionIslamDenominationTwelver ShīʿāMovementHurufismMain interest(s)Sufism Fażlu l-Lāh Astar-Ābādī (Persian: فضل‌الله استرآبادی, 1339/40 in Astarābād – 1394 in Nakhchivan), also known as Fażlullāh Tabrīzī Astarābādī[1][2] by a pseudonym al-Ḥurūfī[1] and a pen name Nāimī, was an Iranian mystic who founded the ...

 

Juin 1944 Nombre de jours 30 Premier jour Jeudi 1er juin 19444e jour de la semaine 22 Dernier jour Vendredi 30 juin 19445e jour de la semaine 26 Calendrier juin 1944 Sem Lu Ma Me Je Ve Sa Di 22 1er 2 3 4 23 5 6 7 8 9 10 11 24 12 13 14 15 16 17 18 25 19 20 21 22 23 24 25  26 26 27 28 29 30 1944 • Années 1940 • XXe siècle Mois précédent et suivant Mai 1944 Juillet 1944 Juin précédent et suivant Juin 1943 Juin 1945 Chronologies par zone géographique Chronolog...

Star in the constellation Pavo HD 186302 Location of HD 186302 (circled) Observation dataEpoch J2000      Equinox J2000 Constellation Pavo Right ascension 19h 49m 06.43036s[1] Declination −70° 11′ 16.7033″[1] Apparent magnitude (V) 8.76±0.01[2] Characteristics Spectral type G3/5 V[3] B−V color index 0.67[4] AstrometryRadial velocity (Rv)−1.3±0.3[5] km/sProper mo...

 

Bulu tangkis memulai debutnya pada ajang Commonwealth Games pada tahun 1966. Namun, pertandingan beregu campuran baru digelar pada tahun 1978, tetapi dihentikan karena pada tahun 1988 diusulkan untuk diadakan nomor beregu putra dan beregu putri. Lokasi Penyelenggaraan Commonwealth Games Tabel di bawah memperlihatkan semua kota dan negara yang pernah menjadi tuan rumah untuk Commonwealth Games. Tahun Kota Penyelenggara Negara 1966 Kingston  Jamaika 1970 Edinburgh  Skotlandia 1974 Chr...

 

Main article: 2011 Libyan civil war The events regarding the military intervention on 19 March can be tracked in the related articles: Timeline of the 2011 Libyan Civil War before military intervention Timeline of the 2011 Libyan Civil War and military intervention (19 March–May) Timeline of the 2011 Libyan Civil War and military intervention (June–15 August) Map of LibyaSituation as of 20 October. The Libyan Civil War began on 17 February 2011 as a civil protest and later evolved into a...

U.S. presidential election in Maryland Main article: 1940 United States presidential election 1940 United States presidential election in Maryland ← 1936 November 5, 1940[1] 1944 → All 8 Maryland votes to the Electoral College   Nominee Franklin D. Roosevelt Wendell Willkie Party Democratic Republican Home state New York New York Running mate Henry A. Wallace Charles L. McNary Electoral vote 8 0 Popular vote 384,546 269,534 Percentage 58....

 

Tourism agency for Las Vegas Las Vegas Convention and Visitors AuthorityIndustrytourismconventionsFounded1955; 69 years ago (1955)FounderNevada LegislatureHeadquartersWinchester, Nevada, U.S.Area servedSouthern NevadaTotal assetsLas Vegas Convention CenterWebsitelvcva.com The Las Vegas Convention and Visitors Authority (LVCVA) is a government agency and the official destination marketing organization for Southern Nevada.[1] It was founded by the Nevada Legislature in...

 

1920 film The Prince of Avenue AContemporary lobby cardDirected byJohn FordWritten byCharles DazeyFrank Mitchell DazeyCharles J. WilsonProduced byCarl LaemmleStarringJames J. CorbettCinematographyJohn W. BrownDistributed byUniversal Film Manufacturing CompanyRelease date January 11, 1920 (1920-01-11) Running time50 minutesCountryUnited StatesLanguageSilent (English intertitles) The Prince of Avenue A is a 1920 American drama film directed by John Ford. The film is considered to...

Come leggere il tassoboxCattleya labiataStato di conservazioneSpecie non valutata Classificazione APG IVDominioEukaryota OrdineAsparagales FamigliaOrchidaceae SottofamigliaEpidendroideae TribùEpidendreae SottotribùLaeliinae GenereCattleya SpecieC. labiata Classificazione CronquistDominioEukaryota RegnoPlantae DivisioneMagnoliophyta ClasseLiliopsida OrdineOrchidales FamigliaOrchidaceae SottofamigliaEpidendroideae TribùEpidendreae SottotribùLaeliinae GenereCattleya SpecieC. labiata Nomencla...

 

Voce principale: Giochi della XVI Olimpiade. Voce principale: Calcio ai Giochi della XVI Olimpiade. Calcio ai Giochi della XVI Olimpiade - Qualificazioni Competizione Calcio ai Giochi della XVI Olimpiade - Qualificazioni Sport Calcio Edizione 1ª Organizzatore FIFA Date dal 23 ottobre 1955al 31 luglio 1956 Luogo Mondo Partecipanti 24 Statistiche Miglior marcatore ignoto[1] Incontri disputati 10 Gol segnati 46 (4,6 per incontro) Cronologia della competizione 1960 Manuale Per...