CHRNB2

CHRNB2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CHRNB2, EFNL3, nAChRB2, cholinergic receptor nicotinic beta 2 subunit
Зовнішні ІД OMIM: 118507 MGI: 87891 HomoloGene: 595 GeneCards: CHRNB2
Пов'язані генетичні захворювання
autosomal dominant nocturnal frontal lobe epilepsy 3[1]
Реагує на сполуку
pozanicline, ispronicline[2]
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000748
NM_009602
RefSeq (білок)
NP_000739
NP_033732
Локус (UCSC) Хр. 1: 154.57 – 154.58 Mb Хр. 3: 89.65 – 89.67 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CHRNB2 (англ. Cholinergic receptor nicotinic beta 2 subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми.[5] Довжина поліпептидного ланцюга білка становить 502 амінокислот, а молекулярна маса — 57 019[6].

Послідовність амінокислот
1020304050
MARRCGPVALLLGFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPAT
NGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFD
NMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAI
YKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPS
GEWDIVALPGRRNENPDDSTYVDITYDFIIRRKPLFYTINLIIPCVLITS
LAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKY
LMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQ
QPRHHCARQRLRLRRRQREREGAGALFFREAPGADSCTCFVNRASVQGLA
GAFGAEPAPVAGPGRSGEPCGCGLREAVDGVRFIADHMRSEDDDQSVSED
WKYVAMVIDRLFLWIFVFVCVFGTIGMFLQPLFQNYTTTTFLHSDHSAPS
SK

Кодований геном білок за функціями належить до рецепторів, іонних каналів. Задіяний у таких біологічних процесах як транспорт іонів, транспорт, поліморфізм. Локалізований у клітинній мембрані, мембрані, клітинних контактах, синапсах.

Література

  • Anand R., Lindstrom J. (1990). Nucleotide sequence of the human nicotinic acetylcholine receptor beta 2 subunit gene. Nucleic Acids Res. 18: 4272—4272.  PMID 2377478 DOI:10.1093/nar/18.14.4272
  • Groot Kormelink P.J., Luyten W.H.M.L. (1997). Cloning and sequence of full-length cDNAs encoding the human neuronal nicotinic acetylcholine receptor (nAChR) subunits beta3 and beta4 and expression of seven nAChR subunits in the human neuroblastoma cell line SH-SY5Y and/or IMR-32. FEBS Lett. 400: 309—314.  PMID 9009220 DOI:10.1016/S0014-5793(96)01383-X
  • Rempel N., Heyers S., Engels H., Sleegers E., Steinlein O.K. (1998). The structures of the human neuronal nicotinic acetylcholine receptor beta2- and alpha3-subunit genes (CHRNB2 and CHRNA3). Hum. Genet. 103: 645—653.  PMID 9921897 DOI:10.1007/s004390050885
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004.  PMID 15489334 DOI:10.1101/gr.2596504
  • Kouvatsos N., Giastas P., Chroni-Tzartou D., Poulopoulou C., Tzartos S.J. (2016). Crystal structure of a human neuronal nAChR extracellular domain in pentameric assembly: Ligand-bound alpha2 homopentamer. Proc. Natl. Acad. Sci. U.S.A. 113: 9635—9640.  PMID 27493220 DOI:10.1073/PNAS.1602619113
  • Bondarenko V., Tillman T., Xu Y., Tang P. (2010). NMR structure of the transmembrane domain of the n-acetylcholine receptor beta2 subunit. Biochim. Biophys. Acta. 1798: 1608—1614.  PMID 20441771 DOI:10.1016/j.bbamem.2010.04.014

Примітки

Див. також


Read other articles:

Artikel ini sebatang kara, artinya tidak ada artikel lain yang memiliki pranala balik ke halaman ini.Bantulah menambah pranala ke artikel ini dari artikel yang berhubungan atau coba peralatan pencari pranala.Tag ini diberikan pada Januari 2023. Diam Diam MesraAlbum studio karya Itje TrisnawatiDirilis1982GenreDangdutLabelInsan RecordsKronologi Itje Trisnawati Jangan Cemburu (1982)Jangan Cemburu1982 Diam Diam Mesra (1982) Karena Senyuman (1983)Karena Senyuman1983 Diam Diam Mesra merupakan a...

 

Haselau. Haselau adalah kota yang terletak di distrik Pinneberg, Schleswig-Holstein, Jerman. Kota Haselau memiliki luas sebesar 18.88 km². Haselau pada tahun 2006, memiliki penduduk sebanyak 1.159 jiwa. lbsKota dan kotamadya di Pinneberg (distrik) Appen Barmstedt Bevern Bilsen Bokel Bokholt-Hanredder Bönningstedt Borstel-Hohenraden Brande-Hörnerkirchen Bullenkuhlen Ellerbek Ellerhoop Elmshorn Groß Nordende Groß Offenseth-Aspern Halstenbek Haselau Haseldorf Hasloh Heede Heidgraben He...

 

The Colombo Express, salah satu kapal peti kemas yang terbesar yang dioperasikan oleh Hapag-Lloyd dari Jerman Kapal peti kemas (Inggris: containership atau celullarship) adalah kapal yang khusus digunakan untuk mengangkut peti kemas yang standar. Memiliki rongga (cells) untuk menyimpan peti kemas ukuran standar. Peti kemas diangkat ke atas kapal di terminal peti kemas dengan menggunakan kran/derek khusus yang dapat dilakukan dengan cepat, baik derek-derek yang berada di dermaga, maupun derek ...

Television channel For VH1 in the United States, see VH1. This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: VH1 European TV channel – news · newspapers · books · scholar · JSTOR (October 2020) (Learn how and when to remove this template message) Television channel VH1Broadcast area List Albania, Austria, ...

 

Marc Hornschuh Marc Hornschuh di FC St. Pauli, 2017Informasi pribadiNama lengkap Marc HornschuhTanggal lahir 2 Maret 1991 (umur 33)Tempat lahir Dortmund, JermanTinggi 187 m (613 ft 6 in)Posisi bermain Bek tengah / gelandang bertahanInformasi klubKlub saat ini Borussia Dortmund IINomor 3Karier junior1994–2002 DJK TuS Körne2002–2009 Borussia DortmundKarier senior*Tahun Tim Tampil (Gol)2009– Borussia Dortmund II 101 (4)2009– Borussia Dortmund 0 (0)2012 → Ingolstad...

 

1990 film by Tobe Hooper Spontaneous CombustionTheatrical release posterDirected byTobe HooperScreenplay byTobe HooperHoward GoldbergStory byTobe HooperProduced byHenry BushkinSanford HamptonJerrold W. LambertJim RogersArthur M. SarkissianStarring Brad Dourif Cynthia Bain Jon Cypher William Prince Melinda Dillon CinematographyLevie IsaacksEdited byDavid KernMusic byGraeme RevellProductioncompaniesBlack Owl ProductionsProject SamsonVOSCDistributed byTaurus EntertainmentRelease date February...

Artikel ini membahas jabatan keagamaan. Untuk penggunaan dalam Islam, lihat Imam (Islam). Pastor Gereja Katolik Roma dalam pakaian tradisional jabatannya. Imam adalah orang yang diberikan wewenang untuk menyelenggarakan upacara keagamaan. Jabatan atau kedudukan mereka disebut imamat, istilah yang juga dapat digunakan secara kolektif. Sejak dahulu dan dalam masyarakat-masyarakat yang paling sederhana pun telah hadir pemimpin upacara keagamaan yang disebut imam (lihat shaman dan orakel). Dalam ...

 

Pay television channel This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Nickelodeon Latin American TV channel – news · newspapers · books · scholar · JSTOR (March 2010) (Learn how and when to remove this message) Television channel Nickelodeon (Latin America)Logo used since August 29, 2023[a]Broa...

 

  جمهورية التشيك (بالتشيكية: Česká republika)‏  جمهورية التشيكعلم التشيك جمهورية التشيكشعار التشيك   الشعار الوطني(بالتشيكية: Pravda vítězí.)‏  النشيد:  نشيد جمهورية التشيك الوطني  الأرض والسكان إحداثيات 50°N 15°E / 50°N 15°E / 50; 15   [1] أعلى قمة سنيجكا[2]...

Comme si de rien n'étaitAlbum studio karya Carla BruniDirilis11 Juli 2008 (2008-07-11)Direkam2007 - 2008GenreRakyat, chansonDurasi42:21LabelNaïveProduserDominique Blanc-FrancardKronologi Carla Bruni No Promises(2007)No Promises2007 Comme si de rien n'était(2008) Singel dalam album Comme si de rien n'était L'AmoureuseDirilis: 9 Juli 2008 Comme si de rien n'était (Indonesia: Seolah Tak Terjadi Apa-Apacode: id is deprecated ) adalah album ketiga penyanyi Italia-Prancis dan ibu ...

 

Artikel ini bukan mengenai Kereta rel listrik seri EA203. Kereta Api Airport Railink Service KualanamuAKereta api bandara ARS Kualanamu dengan livery terbaru tiba di Stasiun Bandar KhalipahInformasi umumJenis layananEksekutifStatusBeroperasiDaerah operasiDivisi Regional I MedanMulai beroperasi25 Juli 2013; 10 tahun lalu (2013-07-25) (rute Medan-Kualanamu)Operator saat iniKAI BandaraSitus webhttps://www.railink.co.id/Lintas pelayananStasiun awalMedanJumlah pemberhentian5Stasiun akhirKuala...

 

This article relies largely or entirely on a single source. Relevant discussion may be found on the talk page. Please help improve this article by introducing citations to additional sources.Find sources: 1994 FA Trophy final – news · newspapers · books · scholar · JSTOR (March 2021) Football match1994 FA Trophy FinalVauxhall FA Trophy FinalEvent1993–94 FA Trophy Woking Runcorn 2 1 Date21 May 1994VenueWembley Stadium, LondonRefereePaul DurkinAttenda...

2004 studio album by Paul WellerStudio 150Studio album by Paul WellerReleased14 September 2004StudioStudio 150, Amsterdam; Black Barn Studios, Woking, SurreyGenreRock, soulLength45:51LabelV2 RecordsProducerPaul WellerJan KybertPaul Weller chronology Fly on the Wall: B Sides & Rarities(2003) Studio 150(2004) As Is Now(2005) Professional ratingsAggregate scoresSourceRatingMetacritic48/100[1]Review scoresSourceRatingAllmusic[2]BBC Music(neutral)[3]Music Box&#...

 

This article includes a list of general references, but it lacks sufficient corresponding inline citations. Please help to improve this article by introducing more precise citations. (October 2020) (Learn how and when to remove this message) You can help expand this article with text translated from the corresponding article in German. (October 2020) Click [show] for important translation instructions. View a machine-translated version of the German article. Machine translation, like De...

 

Japanese train type 455 seriesA JR East 455 series in 2006In serviceOctober 1965–March 2015 (general service) 2015–2021 (remaining driving cab mixed from 413/455 series trainsets of JR West)Constructed1965–1971Number in service2 vehiclesNumber preserved3 vehiclesOperatorsJNR (1965–1987)JR East (1987–2008)JR Kyushu (1987–2010)JR West (1987–2015, 2015-2021)Echigo Tokimeki Railway (2021–)SpecificationsCar body constructionSteelCar length20,000 mm ...

Artikel ini sebatang kara, artinya tidak ada artikel lain yang memiliki pranala balik ke halaman ini.Bantulah menambah pranala ke artikel ini dari artikel yang berhubungan atau coba peralatan pencari pranala.Tag ini diberikan pada Desember 2022. Koordinat: 40°48′13″N 22°03′20″E / 40.8037112596617°N 22.05557942390442°E / 40.8037112596617; 22.05557942390442 Air terjun Edessa Air terjun Edessa, dilihat dari atas Air Terjun Edessa atau Air Terjun Edessis[1&...

 

Gin

Distilled alcoholic drink flavoured with juniper This article is about the alcoholic beverage. For the card game, see Gin rummy. For other uses, see Gin (disambiguation). GinA selection of bottled gins for sale in Georgia, United States, 2010TypeDistilled alcoholic drinkIntroduced13th centuryAlcohol by volume 35–60%Proof (US)70–140°ColourClearIngredientsBarley or other grain, juniper berriesRelated productsJenever Gin (/dʒɪn/) is a distilled alcoholic drink flavoured with juniper ...

 

US Open 2016Doppio mistoSport Tennis Vincitori Laura Siegemund Mate Pavić Finalisti Coco Vandeweghe Rajeev Ram Punteggio6-4, 6-4 Tornei Singolare uomini (q) donne (q)   ragazzi ragazze Doppio uomini donne misto ragazzi ragazze 2015 2017 Voce principale: US Open 2016. Martina Hingis e Leander Paes erano i campioni in carica ma sono stati eliminati al secondo turno da Coco Vandeweghe e Rajeev Ram. Laura Siegemund e Mate Pavić hanno conquistato il titolo battendo in finale Coco Vandeweghe...

Pour les articles homonymes, voir Crocus (série télévisée d'animation) et CROCUS (Réacteur). Pour les articles ayant des titres homophones, voir Krokus et Chrocus. Crocus Crocus vernus subsp. albiflorusClassification Règne Plantae Division Magnoliophyta Classe Liliopsida Sous-classe Liliidae Ordre Liliales Famille Iridaceae Sous-famille Crocoideae Tribu Ixieae GenreCrocusL., 1753 Classification phylogénétique Classification phylogénétique Ordre Asparagales Famille Iridaceae Crocus ...

 

1942 American romance film This article is about the 1942 American film. For the 2019 Egyptian film, see Casablanca (2019 film). For the similarly titled 1951 French film, see Casabianca (film). Here's looking at you, kid redirects here. For other uses, see Here's Looking at You Kid. CasablancaTheatrical release poster by Bill GoldDirected byMichael CurtizScreenplay by Julius J. Epstein Philip G. Epstein Howard Koch Based onEverybody Comes to Rick'sby Murray BurnettJoan AlisonProduced byHal B...