bacterial/antibiotic peptides, fungal peptides, invertebrate peptides, amphibian/skin peptides, venom peptides, cancer/anticancer peptides, vaccine peptides, immune/inflammatory...

chemistry, peptide synthesis is the production of peptides, compounds where multiple amino acids are linked via amide bonds, also known as peptide bonds....

Peptide therapeutics are peptides or polypeptides (oligomers or short polymers of amino acids) which are used for the treatment of diseases. Naturally...

Glucagon-like peptide-1 (GLP-1) is a 30- or 31-amino-acid-long peptide hormone deriving from tissue-specific posttranslational processing of the proglucagon...

In organic chemistry, a peptide bond is an amide type of covalent chemical bond linking two consecutive alpha-amino acids from C1 (carbon number one)...

Nonribosomal peptides (NRP) are a class of peptide secondary metabolites, usually produced by microorganisms like bacteria and fungi. Nonribosomal peptides are...

Peptide computing is a form of computing which uses peptides, instead of traditional electronic components. The basis of this computational model is the...

A peptide library is a tool for studying proteins. Peptide libraries typically contain a large number of peptides that have a systematic combination of...

Antimicrobial peptides (AMPs), also called host defence peptides (HDPs) are part of the innate immune response found among all classes of life. Fundamental...

Brain natriuretic peptide (BNP), also known as B-type natriuretic peptide, is a peptide hormone secreted by cardiomyocytes in the heart ventricles in...

A peptide biosensor is a type of biosensor that uses peptides or short amino acid fragments as the biorecognition element in detecting a specific analyte...

Glucagon-like peptide-1 (GLP-1) receptor agonists, also known as GLP-1 agonists, GLP-1RAs, and informally as simply GLP-1s, are a class of medications...

Delta-sleep-inducing peptide (DSIP) is a neuropeptide that when infused into the mesodiencephalic ventricle of recipient rabbits induces spindle and delta...

The connecting peptide, or C-peptide, is a short 31-amino-acid polypeptide that connects insulin's A-chain to its B-chain in the proinsulin molecule....

2A peptides are a class of 18–22 aa-long peptides, which can induce ribosomal skipping during translation of a protein in a biological cell. These peptides...

Copper peptide GHK-Cu is a naturally occurring copper complex of the tripeptide glycyl-L-histidyl-L-lysine. The tripeptide has strong affinity for copper(II)...

Peptide T is an HIV entry inhibitor discovered in 1986 by Candace Pert and Michael Ruff, a US neuroscientist and immunologist. Peptide T, and its modified...

Opioid peptides or opiate peptides are peptides that bind to opioid receptors in the brain; opiates and opioids mimic the effect of these peptides. Such...

The peptide-loading complex (PLC) is a short-lived, multisubunit membrane protein complex that is located in the endoplasmic reticulum (ER). It orchestrates...

A signal peptide (sometimes referred to as signal sequence, targeting signal, localization signal, localization sequence, transit peptide, leader sequence...

A D-peptide is a short sequence of D-amino acids connected by peptide bonds. Since ribosomes are specific to L-amino acids, the vast majority of naturally...

A stapled peptide is a modified peptide (class A peptidomimetic), typically in an alpha-helical conformation, that is constrained by a synthetic brace...

In bio-informatics, a peptide-mass fingerprint or peptide-mass map is a mass spectrum of a mixture of peptides that comes from a digested protein being...

p3 peptide also known as amyloid β- peptide (Aβ)17–40/42 is the peptide resulting from the α- and γ-secretase cleavage from the amyloid precursor protein...

Peptide hormones are hormones composed of peptide molecules. These hormones influence the endocrine system of animals, including humans. Most hormones...

Umami peptides are a family of small to medium length polypeptides found in a variety of savoury foods, which impart an umami taste. They are best known...

Peptide PHI, also known as peptide histidine isoleucine, is a peptide which functions as a hormone. This peptide contains a composition of 27 amino acids...

Self-assembling peptides are a category of peptides which undergo spontaneous assembly into ordered nanostructures. Originally described in 1993, these...

Peptide YY (PYY), also known as peptide tyrosine tyrosine, is a peptide that in humans is encoded by the PYY gene. Peptide YY is a short (36-amino acid)...

Gastrin-releasing peptide GRP, is a neuropeptide, a regulatory molecule encoded in the human by the GRP gene. GRP has been implicated in a number of physiological...

RF(Arg-Phe)amide family 26 amino acid peptide, also known as P518, is a human protein. The 26-amino acid RF-amide peptide, P518 functions as a high-affinity...

Monitor peptide, also known as pancreatic secretory trypsin inhibitor I (PSTI-I) or pancreatic secretory trypsin inhibitor 61 (PSTI-61), is a peptide that...

A target peptide is a short (3-70 amino acids long) peptide consensus sequence that directs the transport of a protein to a specific region in the cell...

In solid phase peptide synthesis, a linker is a molecule that connects the solid phase (a beaded resin support) to the growing peptide chain. The linker...

Custom peptide synthesis is the commercial production of peptides for use in biochemistry, biology, biotechnology, pharmacology and molecular medicine...

A peptide microarray (also commonly known as peptide chip or peptide epitope microarray) is a collection of peptides displayed on a solid surface, usually...

Peptide nucleic acid (PNA) is an artificially synthesized polymer similar to DNA or RNA. Synthetic peptide nucleic acid oligomers have been used in recent...

In enzymology, a peptide deformylase (EC 3.5.1.88) is an enzyme that removes the formyl group from the N terminus of nascent polypeptide chains in eubacteria...

Atrial natriuretic peptide (natriuretic polypeptide (ANP) or atrial natriuretic factor (ANF) is a natriuretic peptide hormone secreted from the cardiac...

In mass spectrometry, de novo peptide sequencing is the method in which a peptide amino acid sequence is determined from tandem mass spectrometry. Knowing...

antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence...

spurring the formation of new protein products. They do this by cleaving the peptide bonds within proteins by hydrolysis, a reaction where water breaks bonds...

Asparagine peptide lyase are one of the seven groups in which proteases, also termed proteolytic enzymes, peptidases, or proteinases, are classified according...

Mast cell degranulating (MCD) peptide is a cationic 22-amino acid residue peptide, which is a component of the venom of the bumblebee (Megabombus pennsylvanicus)...

to mimic a peptide. They typically arise either from modification of an existing peptide, or by designing similar systems that mimic peptides, such as peptoids...

free amine group (-NH2) located at the end of a polypeptide. Within a peptide, the amine group is bonded to the carboxylic group of another amino acid...

\rightleftharpoons } 5-oxoprolyl-peptide + NH3 or L-glutamyl-peptide ⇌ {\displaystyle \rightleftharpoons } 5-oxoprolyl-peptide + H2O Hence, this enzyme has...

BRINP2-related peptide (BRP) is a synthetic peptide that displays anti-obesity action similar to semaglutide. It does this without significant muscle loss...

Peptide mass fingerprinting (PMF), also known as protein fingerprinting, is an analytical technique for protein identification in which the unknown protein...

Peptide signaling plays a significant role in various aspects of plant growth and development and specific receptors for various peptides have been identified...

classes of peptide bioregulators as well as for the development of bioregulating peptide therapy. He was engaged in studying of the role of peptides in regulation...

acid peptide C-type natriuretic peptide (CNP). Natriuretic peptides comprise a family of 3 structurally related molecules: atrial natriuretic peptide (ANP)...

Cyclic peptides are polypeptide chains which contain a circular sequence of bonds. This can be through a connection between the amino and carboxyl ends...

Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans...

A peptide sequence tag is a piece of information about a peptide obtained by tandem mass spectrometry that can be used to identify this peptide in a protein...

Bailey peptide synthesis is a name reaction in organic chemistry developed 1949 by J. L. Bailey. It is a method for the synthesis of a peptide from α-amino...

be proteins and are commonly called peptides. The individual amino acid residues are bonded together by peptide bonds and adjacent amino acid residues...

incretin, is to stimulate insulin secretion. GIP, along with glucagon-like peptide-1 (GLP-1), belongs to a class of molecules (incretins) which stimulate...

Arginylglycylaspartic acid (RGD) is the most common peptide motif responsible for cell adhesion to the extracellular matrix (ECM), found in species ranging...

Peptide amphiphiles (PAs) are peptide-based molecules that self-assemble into supramolecular nanostructures including; spherical micelles, twisted ribbons...

Beta-peptides (β-peptides) are peptides derived from β-amino acids, in which the amino group is attached to the β-carbon (i.e. the carbon two atoms away...

identify peptides which bind to a particular molecular target. The process utilizes two main components: an immobilized target and a peptide library in...

CLE peptides (CLAVATA3/Embryo Surrounding Region-Related) are a group of peptides found in plants that are involved with cell signaling. Production is...

The glucagon-like peptide-1 receptor (GLP1R) is a G protein-coupled receptor (GPCR) found on beta cells of the pancreas and on neurons of the brain. It...

types of natriuretic peptides: atrial natriuretic peptide (ANP), brain natriuretic peptide (BNP), and C-type natriuretic peptide (CNP). Two minor hormones...

Paralytic peptides are a family of short (23 amino acids) insect peptides that halt metamorphosis of insects from larvae to pupae. These peptides contain...

Peptide-based synthetic vaccines (epitope vaccines) are subunit vaccines made from peptides. The peptides mimic the epitopes of the antigen that triggers...

In molecular biology, the Signal Peptide Peptidase (SPP) is a type of protein that specifically cleaves parts of other proteins. It is an intramembrane...

Internalizing RGD (iRGD) peptides are a class of 9-amino acid cyclic peptides containing an RGD sequence, which undergo internalization as discussed below...

Beefy meaty peptide, also known as delicious peptide and abbreviated as BMP, is an 8-amino acid long peptide that has been identified as giving a beefy...

Journal of Peptide Science is a monthly peer-reviewed scientific journal, published since 1995 by John Wiley & Sons on behalf of the European Peptide Society...

Peptide 021 (Ac-DGGLAG-NH2, P021, GLXC-21260) is a synthetic peptide derivative that is derived from a 4-amino acid active fragment of ciliary neurotrophic...

intestinal peptide, also known as vasoactive intestinal polypeptide or VIP, is a peptide hormone that is vasoactive in the intestine. VIP is a peptide of 28...

fibrils into smaller peptides; depending on the physical and chemical methods of denaturation, the molecular weight of the peptides falls within a broad...

and there is limited data regarding its effectiveness on humans. The peptide has gained popularity among athletes and the general public for injury...

Calcitonin gene-related peptide (CGRP) is a neuropeptide that belongs to the calcitonin family. Human CGRP consists of two isoforms, CGRP alpha (α-CGRP...

scavenger in peptide synthesis. It can also act as a mild reducing agent. In peptide synthesis, TIPS is used as a scavenger for peptide groups being removed...

I MHC molecules bind peptides generated mainly from the degradation of cytosolic proteins by the proteasome. The MHC I: peptide complex is then inserted...

Silk peptides, also known as silk amino acids (SAAs), are a water-soluble mixture of short to medium chain peptides and glycoproteins derived from hydrolysis...

catalyzes the chemical reaction NAD+ + peptide diphthamide ⇌ {\displaystyle \rightleftharpoons } nicotinamide + peptide N-(ADP-D-ribosyl)diphthamide Thus,...

not possess neurons, use peptides for cell-to-cell communication in a way similar to the neuropeptides of higher animals. Peptide signals play a role in...

Pro-gastrin-releasing-peptide, also known as Pro-GRP, is a gastrin-releasing peptide (GRP) precursor, a neurotransmitter that belongs to the bombesin-related...

Ribosomally synthesized and post-translationally modified peptides (RiPPs), also known as ribosomal natural products, are a diverse class of natural products...

Peptide plane flipping is a type of conformational change that can occur in proteins by which the dihedral angles of adjacent amino acids undergo large-scale...

Photoactivated peptides are modified natural or synthetic peptides whose functions can be activated or controlled using light. These peptides incorporate...

In enzymology, a peptide-transporting ATPase (EC 3.6.3.43) is an enzyme that catalyzes the chemical reaction ATP + H2O + peptidein ⇌ {\displaystyle \rightleftharpoons...

N-Terminal domain antiandrogens are a novel type of antiandrogen that bind to the N-terminal domain of the androgen receptor (AR) instead of the ligand-binding...

The Downstream-peptide motif refers to a conserved RNA structure identified by bioinformatics in the cyanobacterial genera Synechococcus and Prochlorococcus...

Competence stimulating peptides (CSP) are chemical messengers that assist the initiation of quorum sensing, and exist in many bacterial genera. Bacterial...

1999. The hormone name is based on its role as a growth hormone-releasing peptide, with reference to the Proto-Indo-European root gʰre-, meaning "to grow"...

Protein primary structure is the linear sequence of amino acids in a peptide or protein. By convention, the primary structure of a protein is reported...

peptide (CGRP) receptor antagonists, commonly known as gepants, are a class of drugs that act as antagonists of the calcitonin gene-related peptide receptor...

protein precursor, also called a pro-protein or pro-peptide, is an inactive protein (or peptide) that can be turned into an active form by post-translational...

Signaling peptide receptor is a type of receptor which binds one or more signaling peptides or signaling proteins. An example is the tropomyosin receptor...

reaction L(or D)-glutamine + D-glutamyl-peptide ⇌ {\displaystyle \rightleftharpoons } NH3 + 5-glutamyl-D-glutamyl-peptide The 3 substrates of this enzyme are...

natriuretic peptide (DNP) is a 38-residue peptide and a member of natriuretic peptide family. It is structurally similar to the atrial natriuretic peptide (ANP)...

Natriuretic peptide receptor B (NPR2), also known as atrionatriuretic peptide receptor B and formerly as guanylate cyclase B, is an atrial natriuretic peptide receptor...

(mitochondrial open reading frame of the 12S rRNA-c) is a 16-amino-acid peptide that in humans is encoded by the mitochondrial MT-RNR1 gene, with the amino...

Epitalon is a synthetic peptide, telomerase activator, and putative anti-aging compound, which was identified as the putative active component of a bovine...

Natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A), also known as NPR1, is an atrial natriuretic peptide receptor....

\rightleftharpoons } peptide formylkynurenine Thus, the two substrates of this enzyme are peptide tryptophan and O2, whereas its product is peptide formylkynurenine...

reduce the risk of heart attacks. Semaglutide is a peptide similar to the hormone glucagon-like peptide-1 (GLP-1), modified with a side chain, and acts as...

Peptide receptor radionuclide therapy (PRRT) is a type of radionuclide therapy, using a radiopharmaceutical that targets peptide receptors to deliver localised...

trim efficiently peptides that already have optimal length for MHC class I presentation. Thus ERAP2 has been shown to shorten peptides of 9 or fewer amino...

Peptide transporter 1 (PepT 1) also known as solute carrier family 15 member 1 (SLC15A1) is a protein that in humans is encoded by SLC15A1 gene. PepT...

Prolactin-releasing peptide (PrRP) is a peptide hormone that in humans is encoded by the PRLH gene. PrRP binds to the receptor PrRPR and seems to be involved...

Urotensin II-related peptide (URP) is a cyclic neuropeptide that is found in all vertebrates that have been genome sequenced so far. It has a long lasting...

PeptideAtlas is a proteomics data resource that gathers tandem mass spectrometry datasets from around the world, reprocesses them with the Trans-Proteomic...

base-labile amine protecting group used in organic synthesis, particularly in peptide synthesis. It is popular for its stability toward acids and hydrolysis...

Cysteine-rich proteins (CRP, cysteine-rich peptide or disulphide-rich peptide) are small proteins that contain a large number of cysteines. These cysteines...

(from peptides) and a RNA (from nucleotides). In this Peptide-RNA World scenario, RNA would have contained the instructions for life, while peptides (simple...

CTAP is an opioid antagonist peptide, which is an analogue of somatostatin. It displays high selectivity for the mu-opioid receptor. CTAP is described...

give a vast array of peptides and proteins assembled by ribosomes. Non-proteinogenic amino acids may arise through nonribosomal peptide synthesis. Modified...

Rockefeller University. Her research considers peptide synthesis. She discovered the glucagon-like peptide-1 (GLP-1) and uncovered its role in glucose metabolism...

peptide 2 (TsPep2) is a peptide isolated from the venom of the Tityus serrulatus (Brazilian yellow scorpion). It belongs to a class of short peptides...

cis and trans isomers of peptide bonds with the amino acid proline. Proline has an unusually conformationally restrained peptide bond due to its cyclic...

acid chain. The addition of an amino acid occurs at the C-terminus of the peptide; thus, translation is said to be amine-to-carboxyl directed. The mRNA carries...

peptides of 36–43 amino acids that are the main component of the amyloid plaques found in the brains of people with Alzheimer's disease. The peptides...

vasoactive intestinal peptide. One of its effects is to stimulate enterochromaffin-like cells. It binds to the vasoactive intestinal peptide receptor and the...

as eye drops for keratoconjunctivitis sicca (dry eyes). It is a cyclic peptide with chain length 11. Common side effects include high blood pressure,...

or Class II-associated invariant chain peptide is the part of the invariant chain (Ii) that binds to the peptide binding groove of MHC class II and remains...

attach to one another with a peptide bond. By convention, a chain under 30 amino acids is often identified as a peptide, rather than a protein. To be...

Agouti-related protein (AgRP), also called agouti-related peptide, is a neuropeptide produced in the brain by the AgRP/NPY neuron. It is synthesized in...

The RFamide peptide family, or the RFamide-related peptides (RFRPs), are a family of neuropeptides. They are characterized by the possession of an Arg-Phe-NH2...

Chemerin peptides are short peptides (on the order of 9 amino acids) that are produced from the carboxyl terminus of the chemokine chemerin. Chemerin...

Orforglipron, sold under the brand name Foundayo, is an oral, non-peptide, small-molecule GLP-1 receptor agonist developed as a weight loss drug by Eli...

Camanni F, Ghigo E, Arvat E (January 1998). "Growth hormone-releasing peptides and their analogs". Frontiers in Neuroendocrinology. 19 (1): 47–72. doi:10...

approach includes detecting peptides, matching the corresponding peptides across multiple LC-MS data, selecting discriminatory peptides. Intact protein expression...

The prolactin-releasing peptide receptor (PrRPR) also known as G-protein coupled receptor 10 (GPR10) is a protein that in humans is encoded by the PRLHR...

pseudonym of Robert Wilson Lynd (1879–1949), Irish essayist Peptide YY 3-36, a peptide secreted by the gut in response to a meal, and reduces appetite...

Cell-penetrating peptides (CPPs) are short peptides that facilitate cellular intake and uptake of molecules ranging from nanosize particles to small chemical...

Olah J, Hewitson TD, et al. (2014). "Development of second generation peptides modulating cellular adiponectin receptor responses". Frontiers in Chemistry...

Stable isotope standards and capture by anti-peptide antibodies (SISCAPA) is a mass spectrometry method for measuring the amount of a protein in a biological...

Olah J, Hewitson TD, et al. (2014). "Development of second generation peptides modulating cellular adiponectin receptor responses". Frontiers in Chemistry...

partner. Its core products at launch included the Peptide Glazing Fluid, Barrier Restore Cream and Peptide Lip Treatment. Within 11 days, Rhode had achieved...

Polysaccharide peptide (PSP) is a protein-bound polysaccharide extracted from the edible mushroom Coriolus versicolor. PSP is currently in the animal-testing...

used for detecting the presence of at least two peptide bonds in a molecule. In the presence of peptides, a copper(II) ion forms mauve-colored coordination...

Relaxin family peptide hormones in humans are represented by seven members: three relaxin-like (RLN) and four insulin-like (INSL) peptides: RLN1, RLN2,...

colored hair. Agouti signalling peptide adopts an inhibitor cystine knot motif. Along with the homologous Agouti-related peptide, these are the only known mammalian...

Corticotropin-like intermediate [lobe] peptide (CLIP), also known as adrenocorticotropic hormone fragment 18-39 (ACTH(18-39)), is a naturally occurring...

catalyzes the conversion of an n+1 residue long peptide with a C-terminal glycine into an n-residue peptide with a terminal amide group. In the process,...

In enzymology, a peptide-aspartate beta-dioxygenase (EC 1.14.11.16), a member of the alpha-ketoglutarate-dependent hydroxylases superfamily, is an enzyme...

Oxytocin is a peptide hormone and neuropeptide normally produced in the hypothalamus and released by the posterior pituitary. Present in animals since...

presenting cells (APCs) of the immune system. It does this by assisting in peptide loading of major histocompatibility complex (MHC) class II membrane-bound...

Genome-based peptide fingerprint scanning (GFS) is a system in bioinformatics analysis that attempts to identify the genomic origin (that is, what species...

In enzymology, peptide α-N-acetyltransferase (EC 2.3.1.88) were enzymes that catalyzes the chemical reaction acetyl-CoA + peptide ⇌ {\displaystyle \rightleftharpoons...

glucagon-like peptide receptors (GLPRs) include the following two receptors: Glucagon-like peptide-1 receptor (GLP-1R) – binds Glucagon-like peptide-1 (GLP-1)...

tripeptide is a peptide derived from three amino acids joined by two or sometimes three peptide bonds. As for proteins, the function of peptides is determined...

amino acids in length. This precursor is cleaved to produce the signal peptide, the pancreatic polypeptide, the pancreatic icosapeptide, and a 5- to 7-...

Natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C), also known as NPR3, is an atrial natriuretic peptide receptor....

Adamax (Ac-MEHFPGPAG-NH2) is a synthetic peptide derivative that is a designer analogue of semax, described as semax modified with the N-terminal and...

BmKAEP (or anti-epilepsy peptide) is a neurotoxin from the venom of the Manchurian scorpion (Mesobuthus martensii). It is a β-toxin, which shift the activation...

Bombesin-like peptides comprise a large family of peptides which were initially isolated from amphibian skin, where they stimulate smooth muscle contraction...

formyl peptide receptors (FPR) belong to a class of G protein-coupled receptors involved in chemotaxis. In humans, there are three formyl peptide receptor...

which are non-peptide synthetic small molecules modeled after host defense peptides (HDPs). HDPs, also called antimicrobial peptides, some of which are...

Glucagon-like peptide-2 receptor (GLP-2R) is a protein that in human is encoded by the GLP2R gene located on chromosome 17. The GLP2 receptor (GLP2R)...

hemopressin peptides, named RVD-Hpα and VD-Hpα, bind to CB1 receptors and were originally reported to be agonists. In addition to the Hp peptides from alpha...

specifically the X-Pro peptide bond; steric and electronic factors heavily favor the trans isomer in most other peptide bonds. However, peptide bonds that replace...

is a member of the pentraxin family of proteins. It is not related to C-peptide (insulin) or protein C (blood coagulation). C-reactive protein was the...

Cenderitide (also known as chimeric natriuretic peptide or CD-NP) is a natriuretic peptide developed by the Mayo Clinic as a potential treatment for heart...

gastrin-releasing peptide receptor (GRPR), now properly known as BB2 is a G protein-coupled receptor whose endogenous ligand is gastrin releasing peptide. In humans...

(CRLR), is a human protein; it is a receptor for calcitonin gene-related peptide. RNA expression charts show highest expression in lung and adipose tissue...

Tachykinin peptides are one of the largest families of neuropeptides, found from amphibians to mammals. They were so named due to their ability to rapidly...

(C-terminal) end of a peptide. First demonstrated by Max Bergmann in 1934, it is a rarely used method for sequencing peptides. The later developed Edman...

WALP peptides are a class of synthesized, membrane-spanning α-helices composed of tryptophan (W), alanine (A), and leucine (L) amino acids. They are designed...

the discovery and development of novel peptide-based drugs. Using a proprietary technology platform, Peptides-to-Drugs (P2D), Jerini pursued disease indications...

enzyme inhibitors are zymogens that contain an autoinhibitory N-terminal peptide that binds to the active site of enzyme that intramolecularly blocks its...

vasoactive intestinal peptide and gastric inhibitory peptide Somatostatin family Motilin family Substance P. Ghrelin is a peptide hormone released from...

synthesized and degraded. Each MHC molecule on the cell surface displays a small peptide (a molecular fraction of a protein) called an epitope. The presented self-antigens...

N-terminal prohormone of brain natriuretic peptide (NT-proBNP or BNPT) is a 76 amino acid long protein that is cleaved from the N-terminal end of the...

There are two known receptors for the vasoactive intestinal peptide (VIP) termed VPAC1 and VPAC2. These receptors bind both VIP and pituitary adenylate...

fragments of antigen as peptides bound to major histocompatibility complex (MHC) molecules. The binding between TCR and antigen peptides is of relatively low...

into fragments. An intermediate "middle-down" approach in which larger peptide fragments are analyzed may also sometimes be used. The application of mass...

neuropeptides and peptide hormones. The production of neuropeptides and peptide hormones typically requires two sets of enzymes that cleave the peptide precursors...

Aptamers are oligomers of artificial ssDNA, RNA, XNA, or peptide that bind a specific target molecule, or family of target molecules. They exhibit a range...

Endorphins (contracted from endogenous morphine) are peptides produced in the brain that block the perception of pain and increase feelings of well-being...

Protein tags are peptide sequences genetically grafted onto a recombinant protein. Tags are attached to proteins for various purposes. They can be added...

in the body may trigger an immune response. Antigens can be proteins, peptides (amino acid chains), polysaccharides (chains of simple sugars), lipids...

sequence of amino acids. The ribosomes catalyze the formation of covalent peptide bonds between the encoded amino acids to form a polypeptide chain. Following...

Peptides is a monthly peer-reviewed scientific journal covering the biochemistry, neurochemistry, pharmacology, and biological functions of peptides. It...

natriuretic hormones include: Atrial natriuretic peptide Brain natriuretic peptide C-type natriuretic peptide This is a natural process in infants at the time...

Galanin-like peptide (GALP) is a neuropeptide present in humans and other mammals. It is a 60-amino acid polypeptide produced in the arcuate nucleus of...

Oratrope) is a potent, long-acting, orally-active, selective, and non-peptide agonist of the ghrelin receptor and a growth hormone secretagogue, mimicking...

(antibodies to an individual's own proteins) that are directed against peptides and proteins that are citrullinated. They are present in the majority of...

oxytocin receptor. They include peptides like oxytocin and carbetocin and small-molecules like LIT-001 and LIT-002. Peptide oxytocin receptor agonists are...

discovery of a self-assembling peptide in yeast protein Zuotin. This discovery led to the development of a new field of peptide nanobiotechnology and to designs...

Proton-dependent Oligopeptide Transporter (POT) Family (also called the PTR (peptide transport) family) are found in animals, plants, yeast, archaea and both...

by the order of deprotection. This method is used for the synthesis of peptides, deoxyribonucleic acid (DNA), ribonucleic acid (RNA), and other molecules...

Beta-defensin 2 (BD-2) also known as skin-antimicrobial peptide 1 (SAP1) is a peptide that in humans is encoded by the genes DEFB4A and DEFB4B (defensin...

to the ATP-binding-cassette transporter family. It delivers cytosolic peptides into the endoplasmic reticulum (ER), where they bind to nascent MHC class...

endogenous opioid peptides produced by proenkephalin include adrenorphin, amidorphin, BAM-18, BAM-20P, BAM-22P, peptide B, peptide E, and peptide F. The following...

(cleaves) a peptide bond at the carboxy-terminal (C-terminal) end of a protein or peptide. This is in contrast to an aminopeptidases, which cleave peptide bonds...

Minor histocompatibility antigen (also known as MiHA) are peptides presented on the cellular surface of donated organs that are known to give an immunological...

N-formyl peptide receptor 2 (FPR2) is a G-protein coupled receptor (GPCR) located on the surface of many cell types of various animal species. The human...

tetrapeptide (CCK-4, tetragastrin, Trp-Met-Asp-Phe-NH2) is a peptide fragment derived from the larger peptide hormone cholecystokinin. Unlike cholecystokin which...

active pharmaceutical ingredients (APIs), advanced intermediates, and peptide APIs. Its shares are traded on the Bombay Stock Exchange and the National...

by its limited polymorphisms and small peptide repertoire. Qa-1b binds to peptides derived from signal peptides of MHC class Ia molecule and interact with...

activator neutrophil-activating peptide 2 by proteolytic cleavage of platelet-derived connective tissue-activating peptide III". Cytokine. 3 (4): 311–21...

(3-(diethoxyphosphoryloxy)-1,2,3-benzotriazin-4(3H)-one) is a peptide coupling reagent used in peptide synthesis. It shows remarkable resistance to racemization...

crystalline solid. It is often used for the coupling of amino acids for peptide synthesis and as a reagent in organic synthesis. CDI can be prepared straightforwardly...

A collagen hybridizing peptide (CHP) is a synthetic peptide sequence with typically 6 to 10 repeating units of the Gly-Xaa-Yaa amino acid triplet, which...

extension of the peptide chain by another unit. In a final step the chloride atom is replaced by an amino group, completing the peptide synthesis. Schotten...

a circulating enzyme that acts on a circulating peptide, angiotensinogen. Renin cleaves the peptide at the Leu10–Val11 bond, and this reaction is the...

amino acids in a peptide. In this method, the amino-terminal residue is labeled and cleaved from the peptide without disrupting the peptide bonds between...

Clicked peptide polymers are poly-triazole-poly-peptide hybrid polymers. They are made of repeating units of a 1,2,3-triazole and an oligopeptide. They...

technology and expanded research on the nutrition of fish proteins and peptides, a new industry has developed for the specific purpose of producing a fish...

peptides. Monoamines are synthesized by altering a single amino acid. For example, the precursor of serotonin is the amino acid tryptophan. Peptide neurotransmitters...

Ovalbumin (abbreviated OVA) is the main protein found in egg white, making up approximately 55% of the total protein. Ovalbumin displays sequence and three-dimensional...

Imperatoxin I (IpTx) is a peptide toxin derived from the venom of the African scorpion Pandinus imperator. There are two subtypes of this toxin: Imperatoxin...

176–191 (hGH frag 176–191) is a peptide fragment of human growth hormone. It has erroneously been presented as a lipolytic peptide fragment based on extrapolations...

N-formyl peptide receptor 3 (FPR3) is a receptor protein that in humans is encoded by the FPR3 gene. Confusingly, there are two nomenclatures for FPR...

Pinealon, also known as EDR peptide, is a synthetic tripeptide of sequence (Glu-Asp-Arg) and purported geroprotector documented in the Russian scientific...

An atrial natriuretic peptide receptor is a receptor for atrial natriuretic peptide. NPRA and NPRB are linked to guanylyl cyclases, while NPRC is G-protein-linked...

difficult to achieve high selectivity with peptide derivatives. However the search for a druggable, non-peptide template has led to several potent, highly...

developed by Theratechnologies, Inc. of Canada. The drug is a synthetic peptide consisting of all 44 amino acids of human GHRH with the addition of a trans-3-hexenoic...

of determining the amino acid sequence of all or part of a protein or peptide. This may serve to identify the protein or characterize its post-translational...

Pyroglutamylated RFamide peptide receptor also known as orexigenic neuropeptide QRFP receptor or G-protein coupled receptor 103 (GPR103) is a protein...

Corin, also called atrial natriuretic peptide-converting enzyme, is a protein that in humans is encoded by the CORIN gene. Human corin, a polypeptide...

A peptide spectral library is a curated, annotated and non-redundant collection/database of LC-MS/MS peptide spectra. One essential utility of a peptide...

the toxins in centipede venom are mostly unknown. A peptide named S. mutilans venom toxin peptide (SsmTP) and S. mutilans 6 were identified in S. mutilans's...

clearance. Vancomycin is a branched tricyclic glycosylated nonribosomal peptide produced by the Actinomycetota species Amycolatopsis orientalis (formerly...

group of the glutamate side chain with a gamma peptide linkage, and to glycine with a normal peptide bond. In GSH, G stands for glutathione as a whole...

and the resulting peptides are separated by liquid chromatography. Tandem mass spectrometry is then used to identify the peptides. Targeted proteomics...

lysosomal enzymes degrade the proteins into peptide fragments. These fragments are then loaded into the peptide-binding groove of the MHC class II molecule...

Relaxin/insulin-like family peptide receptor 3, also known as RXFP3, is a human G-protein coupled receptor. Relaxin receptor ENSG00000277069 GRCh38: Ensembl...

which selects for peptides that bind to a given target. All peptide sequences obtained from biopanning using combinatorial peptide libraries have been...

Small humanin-like peptides (SHLPs) are a group of peptides encoded in the 16S ribosomal RNA region of mitochondrial genome. Six peptides of this group (SHLP1–6)...

N-formylated tripeptide and sometimes simply referred to as chemotactic peptide is a potent polymorphonuclear leukocyte (PMN) chemotactic factor and is...

melanocortin receptors or inhibit enkephalinase enzymes. Chemically, Semax is a peptide and a synthetic analogue of a fragment of adrenocorticotropic hormone (ACTH)...

α-helices and hydrophobic fusion peptides located near the N-terminus (some examples show internal fusion peptides, however). Fusion conformation change...

the Nobel Prize in Chemistry in 1984 for the invention of solid phase peptide synthesis. He was born in Fort Worth, Texas, on 15 July 1921, the only...

A cryptide, also known as cryptein or cryptic peptide, is a bioactive peptide produced by proteolytic cleavage of a larger precursor protein, whose biological...

Lingual antimicrobial peptide (LAP) is a beta-defensin found in bovine internal epithelial tissue, in particular, that of the digestive tract. It has...

disease. Aβ plaques are dense, mostly insoluble deposits of amyloid beta peptide and cellular material outside and around neurons. Neurofibrillary tangles...

Crustacean cardioactive peptide (CCAP) is a highly conserved, amidated cyclic nonapeptide with the primary structure PFCNAFTGC-NH2 (ProPheCysAsnAlaPheThrGlyCys-NH2)...

cysto, "sac"; kinin, "move"; hence, move the bile-sac (gallbladder)) is a peptide hormone of the gastrointestinal system responsible for stimulating the...

plant peptide hormone involved in the wound response in the family Solanaceae. It was the first plant hormone that was proven to be a peptide having...

(AVP) or argipressin, is a hormone synthesized from the AVP gene as a peptide prohormone in neurons in the hypothalamus, and is converted to AVP. It...

Incretins are a group of peptide metabolic hormones that decrease blood glucose levels. Incretins are released after eating and augment the secretion...

(Hexafluorophosphate Azabenzotriazole Tetramethyl Uronium) is a reagent used in peptide coupling chemistry to generate an active ester from a carboxylic acid....

amyloid in Homo sapiens: Intralumenal domain of melanocyte protein PMEL Peptide/protein hormones stored as amyloids within endocrine secretory granules...

proteolytic peptides or their tandem mass spectra with those predicted from a sequence database or annotated peptide spectral in a peptide spectral library...

A tetrapeptide is a peptide, classified as an oligopeptide, since it only consists of four amino acids joined by peptide bonds. Many tetrapeptides are...

amino acids are incorporated into nonribosomal peptides which are synthesized by non-ribosomal peptide synthetases. Both eukaryotes and prokaryotes can...

Vasoactive intestinal peptide receptor 2 also known as VPAC2, is a G-protein coupled receptor that in humans is encoded by the VIPR2 gene. VIPR2 is expressed...

Formyl peptide receptor 1 (FPR1, FPR1 receptor, fMet-Leu-Phe receptor 1, FMLP receptor 1, or N-formylmethionyl-leucyl-phenylalanine receptor 1) is a cell...

affects the rate of peptide bond formation between proline and other amino acids. When proline is bound as an amide in a peptide bond, its nitrogen is...

Selank (Russian: Cеланк) is a nootropic anxiolytic peptide based drug developed by the Institute of Molecular Genetics of the Russian Academy of Sciences...

another peptide. Officially, hypocretin (HCRT) is used to refer to the genes and transcripts, while orexin is used to refer to the encoded peptides. There...

facilitate translational elongation from the formation of the first to the last peptide bond of a growing polypeptide. Most common elongation factors in prokaryotes...

manufacturing organization (CDMO) that specializes in the production of peptides and oligonucleotides. The company provides custom synthesis, process development...

Do6a is a venom peptide found in the venom of the Velvet ant (Mutillidae). It targets Pickpocket/Balboa ion channels in class IV dendritic arborizing...

suppress the racemization and to improve the efficiency of peptide synthesis. Automated peptide synthesis involves the condensation of the amino group of...

also known as human growth hormone (hGH or HGH) in its human form, is a peptide hormone that stimulates growth, cell reproduction, and cell regeneration...

Ipamorelin (INN; development code NNC 26-0161) is a peptide selective agonist of the ghrelin/growth hormone secretagogue receptor (GHS) and a growth hormone...

Grammostola rosea). This amphiphilic peptide, which consists of 35 amino acids, belongs to the inhibitory cysteine knot (ICK) peptide family. It reduces mechanical...

chromatography–mass spectrometry, with metabolite profiling enabling identification of peptide-derived products in biological samples. Ac-SDKP Adamax BPC-157 CJC-1295...

Merrifield, started investigating the solid-phase synthesis of peptides. Synthesis of peptides in a combinatorial fashion quickly leads to large numbers of...

Nisin is a polycyclic antibacterial peptide produced by the bacterium Lactococcus lactis that is used as a food preservative. It has 34 amino acid residues...

nonribosomal peptide synthetases, which can be big protein complexes, each specializing in synthesizing only one type of peptide. Nonribosomal peptides often...

surrounded by molecules that are amphipathic molecules including proteins, peptides, and synthetic polymers. It is composed of a lipid bilayer of phospholipids...

real-time technique. Cell display systems were first used in 1985, when peptides were genetically fused with proteins displayed on the M13 bacteriophage...

hypercalcemia of cancer. Identification of a novel parathyroid hormone-like peptide". The New England Journal of Medicine. 319 (9): 556–563. doi:10.1056/NEJM198809013190906...

use of tandem MS is the analysis of biomolecules, such as proteins and peptides. The molecules of a given sample are ionized and the first spectrometer...

regulated by androgens, the genitofemoral nerve, and calcitonin gene-related peptide. During the second and third trimester, testicular development concludes...

Serine proteases (or serine endopeptidases) are enzymes that cleave peptide bonds in proteins. Serine serves as the nucleophilic amino acid at the enzyme's...

sweet odor. Its primary use is to couple amino acids during artificial peptide synthesis. The low melting point of this material allows it to be melted...

be the principal physiologic action of GIP. Together with glucagon-like peptide-1, GIP is largely responsible for the secretion of insulin after eating...

articles on peptides and their receptors and the role of these neuropeptides in the immune system. She held a number of patents for modified peptides in the...

as a spacer group in synthetic peptides). Retatrutide is synthetically engineered and produced using solid-phase peptide synthesis (SPPS). This is when...

breakdown of proteins and polypeptides. Chymotrypsin preferentially cleaves peptide amide bonds where the side chain of the amino acid N-terminal to the scissile...

for her contributions in peptide chemical synthesis, especially in the synthesis of biologically/enzymatically active peptides. Photaki was in 1965 the...

histocompatibility complex (MHC) on chromosome 6 and presents antigenic peptides (derived from self and non-self antigens) to T cells. HLA-B27 is strongly...

steroid, prostaglandin), peptides (e.g. insulin, ACTH), carbohydrates, glycosylated proteins (proteoglycans), nucleic acids, etc. Peptide and lipid ligands are...

The Peptide Transporter Carbon Starvation (CstA) Family (TC# 2.A.114) is a member of the APC superfamily and consists of proteins from bacteria and archaea...

for his contributions to the field of organic chemistry, particularly in peptide synthesis and drug development. Albericio earned his Ph.D. in chemistry...

Spiroligomer molecules (also known as bis-peptides) are synthetic oligomers made by coupling pairs of bis-amino acids into a fused ring system. Spiroligomer...

while other GnRH antagonists, such as elagolix and relugolix, are non-peptide and small-molecule compounds. GnRH antagonists compete with natural GnRH...

Nonproprietary Name; brand names Geref, Gerel), also known as GHRH (1-29), is a peptide analogue of growth hormone-releasing hormone (GHRH) which is used as a...

a white solid that is used as a reagent for preparing active esters in peptide synthesis. It can be synthesized by heating succinic anhydride with hydroxylamine...

recognises the peptide being presented by an MHC molecule, expansion of that T cell occurs. MHC tetramers are bioengineered to present a specific peptide that can...

In molecular biology, a termination factor is a protein that mediates the termination of RNA transcription by recognizing a transcription terminator and...

participate in fatty acid (acyl), polyketide (acyl and aryl), and nonribosomal peptide (peptidyl) biosynthesis. The growing molecule is bound to the A(r)/PCP...

substantially to shaping mammalian proteomes. Uncatalysed, the hydrolysis of peptide bonds is extremely slow, taking hundreds of years. Proteolysis is typically...

presenting cells to activate CD4⁺ t-cells as no TCR recognition of MHC II/peptide complexes can occur. Clinically, this is similar to severe combined immunodeficiency...

developmental code name LY-3537031) is a dual agonist of glucagon-like peptide-1 (GLP-1) receptors and gastric inhibitory polypeptide (GIP) receptors...

DALDA (H-Tyr-D-Arg-Phe-Lys-NH2) is a synthetic peptide which acts as a potent and highly selective agonist of the mu opioid receptor. It is a metabolically...

developing peptide-based mobile phone displays and data storage. The company reported it was ready to commercially release these products: peptide-based displays...

completely unexpressed. The expressed peptide contains a three-turn α-helix, and has no symmetry. The length of the peptide depends on where it is produced...

carboxybenzyl method of peptide synthesis he developed with Max Bergmann. This was the first successful method of controlled peptide chemical synthesis and...

peptides, peptide nucleic acids, and even barcode free self-encoded libraries. In contrast to DNA-encoded chemical libraries (DELS), abiotic peptide-encoded...

Astbury in the 1930s. He proposed the idea of hydrogen bonding between the peptide bonds of parallel or antiparallel extended β-strands. However, Astbury...

a tropic peptide hormone synthesized and released from GnRH neurons within the hypothalamus. GnRH is inhibited by testosterone. The peptide belongs to...

peptide among thousands of other peptides presented on the same cell, because an MHC molecule in one cell can bind to quite a large range of peptides...

cleavage by signal peptidase removes the 24-amino acid N-terminal signal peptide, creating a 60-amino acid prohepcidin. Furin-like convertase and α-1 antitrypsin...

Dynorphins (Dyn) are a class of opioid peptides that arise from the precursor protein prodynorphin. When prodynorphin is cleaved during processing by proprotein...

derive from the combination of two iodinated tyrosine amino acid residues. Peptide hormones and protein hormones consist of three (in the case of thyrotropin-releasing...

A mimotope is often a peptide, and mimics the structure of an epitope. Because of this property it causes an antibody response similar to the one elicited...

side effects include allergic reactions. It is a calcitonin gene-related peptide antagonist. It was approved for medical use in the United States in 2018...

melanin-activating peptide receptor, or melanotropin receptor, is a G protein–coupled receptor that binds to a class of pituitary peptide hormones known as...

Dermorphin is a hepta-peptide first isolated from the skin of South American frogs belonging to the genus Phyllomedusa. The peptide is an agonist with high...

This is a list of signaling peptide/protein receptor modulators Agonists: Peptide: Adiponectin ADP-355 ADP-399; Non-peptide: AdipoRon (–)-Arctigenin Arctiin...

secondary metabolites include: Alkaloids Glycosides Lipids Nonribosomal peptides, such as actinomycin-D Phenazines Natural phenols (including flavonoids)...

In enzymology, a peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase (EC 3.5.1.52) is an enzyme that catalyzes a chemical reaction that cleaves...

sued the United States Food and Drug Administration (FDA) over a ban on peptide T, a drug he was using. Woodroof's final years became the basis of the...

targeted proteins become undetectable by Western blot. In 2016 a synthetic peptide-conjugated PMO (PPMO) was found to inhibit the expression of New Delhi...

A mitogen is a small bioactive protein or peptide that induces a cell to begin cell division, or enhances the rate of division (mitosis). Mitogenesis...

journal Peptide Research, which was later merged with the International Journal of Peptide and Protein Research, to become the Journal of Peptide Research...

(abbreviated as LAR) is a naturally occurring lasso peptide antibiotic. It is the first lasso peptide reported to inhibit protein synthesis in bacteria...

synthesized as inactive zymogens with a pro-peptide domain that must be removed before the enzyme is active. The pro-peptide domain is part of the "cysteine switch...

Hadrucalcin is a peptide toxin from the venom of the scorpion Hadrurus gertschi. Hadrucalcin modifies the Ryanodine receptor channels RyR1 and RyR2, found...

Peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11, MsrA, methionine sulphoxide reductase A, methionine S-oxide reductase (S-form oxidizing), methionine...

are exogenous opioid peptides, distinguished from endorphins, or endogenous opioid peptides. Exorphins include opioid food peptides like gluten exorphin...

Signal peptide peptidase-like 2B, also known as SPPL2B, is a human gene. Multiple transcript variants encoding different isoforms have been found for...

an incretin are glucagon-like peptide-1 (GLP-1) and gastric inhibitory peptide (glucose-dependent insulinotropic peptide, GIP). Both GLP-1 and GIP are...

collectively as MSH, also known as melanotropins or intermedins, are a family of peptide hormones and neuropeptides consisting of α-melanocyte-stimulating hormone...

Transduction Domain-fused Dishevelled Binding Motif (PTD-DBM) is a man-made peptide which interacts with the mechanism of the hair loss linked endogenous protein...

Protein chemical synthesis by native peptide ligation of unprotected peptide segments is an interesting complement and potential alternative to the use...

proteins, PCSK9 is inactive when first synthesized, because a section of peptide chains blocks their activity; proprotein convertases remove that section...

plays a role in human maternal recognition of pregnancy. Insulin-Like Peptide 3 (INSL3) is produced by the interstitial Leydig cells located in the adult...

α-Amanitin (alpha-Amanitin) is a cyclic peptide of eight amino acids. It is possibly the most deadly of all the amatoxins, toxins found in several species...

relaxin family peptides: relaxins 1 and 2 relaxin 3 Leydig cell-specific insulin-like peptide (gene INSL3) early placenta insulin-like peptide (ELIP) (gene...

polypeptide/secretin/vasoactive intestinal peptide hormones are a family of evolutionarily related peptide hormones that regulate activity of G-protein-coupled...

pre-pro-opiomelanocortin (pre-POMC), by the removal of a 26-amino-acid-long signal peptide sequence during translation. POMC is part of the central melanocortin system...

physical hydrogel formation, the first one being the gelation of nanofibrous peptide assemblies, usually observed for oligopeptide precursors. The precursors...

space of E. coli. The NH2-terminal extension of MBP, also termed signal peptide, has two roles: (i) it slows down folding of the newly synthesized polypeptide...

circular ligation of peptides and proteins (SICLOPPS) is a biotechnology technique that permits the creation of cyclic peptides. These peptides are produced by...

used to prepare amides from carboxylic acids and amines in the context of peptide synthesis. It can be prepared from 1-hydroxy-7-azabenzotriazole (HOAt)...

full-length protein produces derived peptides as proteolysis-inducing factor (PIF) and other anti-microbial peptides, secreted by human eccrine sweat glands...

peptides that contain carbohydrate moieties (glycans) covalently attached to the side chains of the amino acid residues that constitute the peptide....

A prohormone is a committed precursor of a hormone consisting of peptide hormones synthesized together that has a minimal hormonal effect by itself because...

(Keyserling). It is a peptide of 48 residues, molecular weight 5291.3. This peptide is cleaved from a longer precursor with a signal peptide and a glutamine-rich...

Bone morphogenetic proteins (BMPs) are a group of growth factors also known as cytokines and as metabologens. Professor Marshall Urist and Professor Hari...

Neuronostatin (abbreviated as NST) is a peptide hormone that may regulate portions of the endocrine system via interactions with G protein coupled receptor...

KGOP01 (H-Dmt-d-Arg-Aba-β-Ala-NH2) is a synthetic peptide derivative which acts as a potent agonist of opioid receptors and has analgesic effects. It...

Tachystatins are antimicrobial chitin-binding peptides from Japanese horseshoe crab. Amino acid residues Tyr(14) and Arg(17) in Tachystatin B are thought...

Relaxin/insulin-like family peptide receptor 4, also known as RXFP4, is a human G-protein coupled receptor. GPR100 is a member of the rhodopsin family...

drug affinity complex (DAC) that binds to albumin, thus prolonging the peptide's presence in the bloodstream. It is primarily used for its potential to...

ADCYAP1R1 gene. This receptor binds pituitary adenylate cyclase activating peptide. PAC1 is a membrane-associated protein and shares significant homology...

modulators, but similarly to elagolix (brand name Orilissa), relugolix is a non-peptide, small-molecule compound and is orally active. It suppresses sex hormone...

venom of P. paulista contains a peptide with potential use as a chemotherapeutic substance named Polybia-MP1. This peptide kills cancerous cells while leaving...

Eukaryotic peptide chain release factor GTP-binding subunit ERF3B is an enzyme that in humans is encoded by the GSPT2 gene. GSPT2 is closely related to...

and express peptides in their peptide binding groove. They can express "self" peptides when the cell is healthy as well as foreign peptides when the cell...

human hormones glucagon-like peptide 1 and glucagon, which play a role in blood sugar regulation. The drug is a peptide that is injected under the skin...

Mitochondrial peptide methionine sulfoxide reductase, also known as methionine sulfoxide reductase A, is an enzyme that in humans is encoded by the MSRA...

Prohibitin-targeting peptide 1 (also known as prohibitin-TP01 and TP01; trade name Adipotide) is a peptidomimetic with sequence CKGGRAKDC-GG-D(KLAKLAK)2...

It is the first beta blocker with an associated calcitonin gene-related peptide releasing activity in the heart. Chen IJ, Yeh JL, Lo YC, Sheu SH, Lin YT...

Glucagon is a peptide hormone, produced by alpha cells of the pancreas. It raises the concentration of glucose and fatty acids in the bloodstream and...

and their peptide-binding sites were identified. In the case of gp96 it is not clear whether it can bind peptides in vivo, although its peptide-binding...

structure. Certain family members are similar to the tick anticoagulant peptide (TAP, P17726). This is a highly selective inhibitor of factor Xa in the...

his breakthrough discoveries of the biological actions of glucagon-like peptides GLP-1 and GLP-2, including GLP-1's key role in stimulating glucose-dependent...

GLP1 poly-agonist peptides are a class of drugs that activate multiple peptide hormone receptors including the glucagon-like peptide-1 (GLP-1) receptor...

Eukaryotic peptide chain release factor GTP-binding subunit ERF3A is an enzyme that in humans is encoded by the GSPT1 gene. GSPT1 has been shown to interact...

polypeptides, latent TGF-beta binding protein (LTBP) and latency-associated peptide (LAP). Serum proteinases such as plasmin catalyze the release of active...

conversely blocks the effects of cocaine when they are co-administered. The peptide is found in several areas, among them the ventral tegmental area (VTA)...

acid derivatives (e.g. epinephrine and auxin), protein or peptides (e.g. insulin and CLE peptides), and gases (e.g. ethylene and nitric oxide). Hormones...

involved in reproduction (oxytocin-like peptides) and the other in osmoregulation (vasopressin-like peptides). These hormones have remained highly conserved...

terminal (or the penultimate) peptide bond; the process releases a single amino acid, dipeptide or a tripeptide from the peptide chain. Depending on whether...

Alpha defensins are a family of mammalian defensin peptides of the alpha subfamily. They are also known as cryptdins and are produced within the small...

In enzymology, a peptide-O-fucosyltransferase (EC 2.4.1.221) is an enzyme that catalyzes the chemical reaction in which an alpha-L-fucosylpyranoside residue...

affinity ligands, and used in vivo peptide phage display to prove the concept and develop numerous tumor-homing peptides. Ruoslahti was born in Imatra, Finland...

Thiopeptides (thiazolyl peptides) are a class of peptide antibiotics produced by bacteria. They have antibiotic activity against Gram-positive bacteria...

were archaeal and 27 were bacterial. Halocins are classified as either peptide (≤ 10 kDa; 'microhalocins') or protein (> 10 kDa) antibiotics produced...

AFPep (alpha fetoprotein peptide) is an orally-active, cyclic, 9-amino acid, peptide with a molecular weight of 969 daltons and is derived from the anti-oncogenic...

manufacture of peptides and complex organic molecules for use as active pharmaceutical ingredients (APIs). The company focuses on peptide-based therapeutics...

dose, and darkening of the gums, face, and breasts. The medication is a peptide and acts by activating the melanocortin receptors. Bremelanotide was approved...

microprotein, later named SHMOOSE. Using mass spectrometry, two unique peptide fragments corresponding to SHMOOSE were detected in mitochondrial fractions...

Signal peptide peptidase-like 2A, also known as SPPL2A, is a human gene. This gene is a member of the signal peptide peptidase-like protease (SPPL) family...

low affinity for dynorphins. They are also referred to as μ(mu)-opioid peptide (MOP) receptors. The prototypical μ-opioid receptor agonist is morphine...

heterotetramer. It consists of 2 enzymatic A peptides and 2 non-enzymatic B peptides. XIIIa is a dimer of activated A peptides. Within blood, thrombins cleave fibrinogens...

with the sequence KEDA or Lys-Glu-Asp-Ala. It is one of a number of small peptides developed in Russia in the late 1990s and early 2000s which have antiinflammatory...

Pro-collagen formation: Three modifications of the pre-pro-peptide form the alpha peptide: The signal peptide on the N-terminal is removed. This molecule is called...

indicates that it is composed of proglucagon together with a signal peptide. The signal peptide is a 20 amino acid fragment that signals that the protein needs...

(VH) and light chains (VL) of immunoglobulins, connected with a short peptide linker of ten to about 25 amino acids. Each variable fragment contains...

search engine that uses mass spectrometry data to identify proteins from peptide sequence databases. Mascot is widely used by research facilities around...

molecules such as glutathione to an acceptor that may be an amino acid, a peptide or water (forming glutamate). GGT plays a key role in the gamma-glutamyl...

Signal peptide peptidase 3, also known as UNQ1887, is a human gene. GRCh38: Ensembl release 89: ENSG00000157837 – Ensembl, May 2017 GRCm38: Ensembl release...

precursor protein to one or more prohormones, which are in turn precursors to peptide hormones. In general, the protein consists of the amino acid chain that...

Solute carrier family 15 (H+/peptide transporter), member 2, also known as SLC15A2, is a human gene. Solute carrier family GRCh38: Ensembl release 89:...

Frederick Hisaw. The relaxin family peptide hormones belong to the insulin superfamily and consists of seven peptides of high structural but low sequence...

Defensin, alpha 1 also known as human alpha defensin 1, human neutrophil peptide 1 (HNP-1) or neutrophil defensin 1 is a human protein that is encoded by...

RhTx is a small peptide toxin from Scolopendra subspinipes mutilans, also called the Chinese red-headed centipede. RhTx binds to the outer pore region...

consumed and are made in other organisms. The amino acids are joined by peptide bonds making a polypeptide chain. This polypeptide chain then goes through...

peptide isolated from neutrophil blood cells of cows. The mature peptide is just 13 amino acids, making it one of the smallest antimicrobial peptides...

first chemical synthesis of a fully biologically-active portion of the peptide hormone (adrenocorticotopic hormone - ACTH), and structure-function studies...

filed by Eli Lilly and Company in 2016. This uses standard solid phase peptide synthesis, with an allyloxycarbonyl protecting group on the lysine at position...

hypercholesterolaemia (high cholesterol). It is an orally available macrocyclic peptide and a proprotein convertase subtilisin/kexin type 9 (PCSK9) inhibitor....

specialized to present MHC class II peptides, whereas most nucleated somatic cells present MHC class I peptides. T cell epitopes presented by MHC class...

Daisho (Dso) is an antimicrobial peptide gene family of the fruit fly Drosophila melanogaster. Two Daisho genes (Dso1, Dso2) are encoded in tandem in...

60, peptide hormone inactivating endopeptidase, PHIE) is an enzyme. This enzyme catalyses the following chemical reaction Hydrolysis of peptides of at...

In enzymology, a peptide-methionine (R)-S-oxide reductase (EC 1.8.4.12) is an enzyme that catalyzes the chemical reaction peptide-L-methionine + thioredoxin...

additive for carbodiimides, such as dicyclohexylcarbodiimide (DCC) in peptide synthesis. It acts as a neutralizing reagent for the basicity or nucleophilicity...

growth hormone-inhibiting hormone (GHIH) or by several other names, is a peptide hormone that regulates the endocrine system and affects neurotransmission...

well-characterized families of opioid peptides produced by the body: enkephalins, β-endorphin, and dynorphins. The met-enkephalin peptide sequence is coded for by...

signal peptidase, eukaryotic signal proteinase, leader peptidase, leader peptide hydrolase, leader proteinase, signal peptidase, pilin leader peptidase...

tripeptide with the sequence KED or Lys-Glu-Asp. It is one of a number of small peptides developed in Russia in the late 1990s and early 2000s which are purported...

class I (A, B, and C), all of which are the HLA Class1 group, present peptides from inside the cell. For example, if the cell is infected by a virus,...

Brandon Cochran Act. The bill mandates intensive care units to conduct C-peptide insulin tests for unconscious patients or those presenting with hypoglycemia...

Isopeptidases have also been identified in prokaryotes that express lasso peptides, or peptides with a knotted conformation established by the presence of a non-main-chain...

Ramachandran). The ω angle at the peptide bond is normally 180°, since the partial-double-bond character keeps the peptide bond planar. The figure in the...

receptors and they are activated by the closely related peptide hormones neuropeptide Y, peptide YY and pancreatic polypeptide. These receptors are involved...

retrocyclins, or demidefensins) are a family of mammalian antimicrobial peptides. They are found in non-human 'Old World' primates, but not in human, gorilla...

polypeptide chain by the covalent condensation of two or more unprotected peptides segments. Native chemical ligation is the most effective method for synthesizing...

Jelleine is a family of peptides, isolated from the royal jelly of Apis mellifera iberiensis, a subspecies of the honey bee. This new family has the potential...

Covalitoxin-II is a peptide toxin that is produced by the spider species Coremiocnemis validus. It can induce excitatory, non-lethal behavioral symptoms...

Kunitz-type serine protease inhibitor APEKTx1 is a peptide toxin derived from the sea anemone Anthopleura elegantissima. This toxin has a dual function...

(flexizymes) and their application in mRNA display (RaPID, random nonstandard peptide integrated discovery). Suga was awarded the 2023 Wolf Prize in Chemistry...

Peptide:N-glycosidase F, commonly referred to as PNGase F, is an amidase of the peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase class. PNGase...

Glutaminyl-peptide cyclotransferase is an enzyme that in humans is encoded by the QPCT gene. This gene encodes human pituitary glutaminyl cyclase, which...

of proteomics software are commonly used for peptide identification (protein ID) through de novo peptide sequencing assisted search engine database searching...

the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in...

biology is the creation of a large number of compounds (usually proteins or peptides) through technologies such as phage display. Similar to combinatorial chemistry...

expressed in nearly all cells, and present small peptides to the immune system which surveys for non-self peptides. HLA-C is a locus on chromosome 6, which encodes...

from the hydrolysis of a protein into its component amino acids and/or peptides. Hydrolyzing down to the amino acid level is most commonly achieved using...

focuses on designs of biological molecules, particularly proteins and peptides. He has published over 210 scientific papers, which have cumulatively been...

of a group of neurotoxic peptides isolated from the venom of the marine cone snail, genus Conus. Conotoxins, which are peptides consisting of 10 to 30 amino...

specific type of receptor antagonist which blocks the receptor sites for the peptide hormone cholecystokinin (CCK). There are two subtypes of this receptor...

restricted subset of peptides derived from signal peptides of classical MHC class I molecules, namely HLA-A, B, C, G. These peptides are released from the...

Somatotrophs, which secrete growth hormone (a peptide hormone) Lactotrophs, which secrete prolactin (a peptide hormone) When using standard staining techniques...

Chemical ligation is the chemoselective condensation of unprotected peptide segments enabled by the formation of a non-native bond at the ligation site...

biosynthesised by the non-ribosomal peptide synthetase of the heterodimer proteins CesA and CesB. In non-ribosomal peptide synthetase, individual amino acids...

35-residue basic peptide from the sea anemone Stichodactyla helianthus that blocks a number of potassium channels. Related peptides form a conserved family...

Alamethicin is a channel-forming peptide antibiotic, produced by the fungus Trichoderma viride. It belongs to peptaibol peptides which contain the non-proteinogenic...

an encyclopedia of classical scholarship Brain natriuretic peptide 32, a cardiac peptide Barisan Nasional Pembebasan Patani (BNPP), an insurgent group...

a propeptide (19-133) and the mature peptide (134-345). The amino acid numbers are based on the mature peptide. The protein is stabilised by three disulfide...

hormones, and neurotransmitters. They vary in size from small molecules to peptides, to large proteins. G protein-coupled receptors are involved in many diseases...

(also known as MS/MS or MS2) experiments are used for protein/peptide identification. Peptide identification algorithms fall into two broad classes: database...

evidence that they are also able to modulate gene activity in vivo. In peptide nucleic acid (PNA), the sugar-phosphate backbone of DNA is replaced with...

editor-in-chief is Hilary J. Crichton. The journal has three sections: Peptide Science (established in 1995, published bimonthly), Nucleic Acid Sciences...

Amylin, or islet amyloid polypeptide (IAPP), is a 37-residue peptide hormone. It is co-secreted with insulin from the pancreatic β-cells in the ratio...

neurite growth-promoting factor 1 (NEGF1) or heparin affinity regulatory peptide (HARP) or heparin binding growth associated molecule (HB-GAM) is a protein...

to glutamic acid or pyroglutamic acid (5-oxoproline). In a protein or peptide, these reactions are important because they may alter its structure, stability...

crystal structure determinations of amino acids and peptides and Pauling's prediction of planar peptide bonds; and his relinquishing of the assumption of...

opioid peptide (protein fragment) derived from the digestion of the milk protein casein. Digestive enzymes can break casein down into peptides that have...

Lipidated peptides are a type of peptide amphiphile that incorporate one or more alkyl/lipid chains, attached to a peptide head group. As with peptide amphiphiles...

exist in its free form, but it occurs naturally as a residue found in peptides of microbial origin. Unlike most amino acid residues, it has an unsaturated...

assembly of specific protein complexes, typically via binding to proline-rich peptides in their respective binding partner. Classical SH3 domains are restricted...

Patellamide A is a peptide natural product produced by Prochloron didemni, a cyanobacterial symbiont of Lissoclinum patella, and was first isolated in...

ERAP1 is mainly located in the endoplasmic reticulum (ER), where it trims peptides at their N-terminus, adapting them for presentation by MHC class I molecules...

and humans. The non-peptide NPS receptor antagonist SHA-68 blocks the effects of NPS in animals and is anxiogenic. Several peptide derived NPS agonists...

Afamelanotide is a melanocortin 1 receptor (MC1 receptor) agonist and a synthetic peptide and analogue of α-melanocyte stimulating hormone. It is administered as...

inhibited by endogenous inverse agonists agouti signalling peptide and agouti-related peptide, and activated by synthetic (i.e. afamelanotide) and endogenous...

of this kind use specific tumor antigens, which are usually proteins or peptides, to stimulate immune system against either tumor specific antigens (TSAs)...

Antimicrobial peptide resistance and lipid A acylation protein PagP is a family of several bacterial antimicrobial peptide resistance and lipid A acylation...

defined by the peptide hormones gastrin and cholecystokinin. Gastrin and cholecystokinin (CCK) are structurally and functionally related peptide hormones that...

"Nonpeptide/peptide chimeric ligands for the nociceptin/orphanin FQ receptor: design, synthesis and in vitro pharmacological activity". The Journal of Peptide Research...

characterized as a pain-modulating peptide, with anti-opioid activity on morphine-induced analgesia. In humans, neuropeptide FF peptides are encoded by the NPFF...

biological molecules such as proteins and peptides for sequence analysis. Transferring an electron causes peptide backbone cleavage into c- and z-ions while...

hypoglycemia occurs with concurrent elevations of insulin, proinsulin and C peptide glucagonoma: the symptoms are not all due to glucagon elevations, and include...

structure which is resistant to heat denaturation and proteolysis. CK peptide components of venoms target voltage-gated ion channels but members of the...

solid that is widely used to modify biopolymers, fragment proteins and peptides (cuts the C-terminus of methionine), and synthesize other compounds. The...

downregulating genes that are dispensable in milk and the upregulation of peptide transport. Hundreds of novel small RNAs were identified by Meulen et al...

is the precursor of a cathelicidin, a type of antimicrobial peptide (AMP). The peptide, Hc-CATH, consists of 30 amino acids derived from cleavage of...

techniques have been developed to achieve these ends, the chemical synthesis of peptides often has a lower technical and practical barrier to obtaining small amounts...

LBT-3627 is an experimental peptide drug derived from vasoactive intestinal peptide (VIP) intended to modulate the behavior of immune cells in cases of...

Relaxin/insulin-like family peptide receptor 1, also known as RXFP1, is a human G protein coupled receptor that is one of the relaxin receptors. It is...

WAY-267464 is a potent, selective, non-peptide agonist for the oxytocin receptor, with negligible affinity for the vasopressin receptors. However, though...

in the blood, "read" the peptide presented by the complex. T cells, if functioning properly, only bind to non-self peptides. If binding occurs, a series...

originally identified as a primary active component of Cortexin, a mixture of peptides derived from cow brain cortex tissue. It is claimed to stimulate nerve...

A neurochemical is a small organic molecule or peptide that participates in neural activity. The science of neurochemistry studies the functions of neurochemicals...

A depsipeptide is a peptide in which one or more amide, -C(O)NHR-, linkages are replaced by the corresponding ester, -C(O)OR-. Depsipeptides usually contain...

Oxyopinins are a group of peptide toxins present in the venom of lynx spiders belonging to the genus Oxyopes, from which they derive their name. Oxyopinins...

endocytosis (B cells), processing the antigen into peptide fragments and then displaying those peptides (bound to a class II MHC molecule) on their membrane...

The Bomanin gene family encodes a group of immune peptides that are essential for Drosophila fruit fly defence against infection by many pathogens. The...

Dortoxin (also called dorsotoxin) is a lethal peptide toxin which is secreted by the South African spitting scorpion Parabuthus transvaalicus. Injection...

azlactone peptide synthesis is a classic organic synthesis process for the preparation of dipeptides. In the presence of a base, peptides are formed...

benzotriazole tetramethyl uronium) is a coupling reagent used in solid phase peptide synthesis. It was introduced in 1978 and shows resistance against racemization...

pain-producing substance of honeybee (Apis mellifera) venom. Melittin is a basic peptide consisting of 26 amino acids. The principal function of melittin as a component...

An Oligopeptidase is an enzyme that cleaves peptides but not proteins. This property is due to its structure: the active site of this enzyme is located...

antimicrobial peptide located outside the epithelial cell's membrane of the skin of many species of amphibians, such as Rana chiricahuensis. This peptide has recently...

into three different mature peptides: Protein N1 Glycosylated protein A Peptide P-D (also known as proline-rich peptide IB-5) ENSG00000230657 GRCh38:...

(DEFA4), also known as neutrophil defensin 4 or HNP4, is a human defensin peptide that is encoded by the DEFA4 gene. HNP4 is expressed in the granules of...

Isopeptag is a 16-amino acid peptide tag (TDKDMTITFTNKKDAE) that can be genetically linked to proteins without interfering with protein folding. What...

profiling: identifying translated mRNA regions, observing how nascent peptides are folded, and measuring the amount of specific proteins that are synthesized...

which catalyze the interconversion between the cis and trans isomers of peptide bonds containing the amino acid proline (Pro). They are chaperone molecules...

1-Hydroxy-7-azabenzotriazole (HOAt) is a triazole used as a peptide coupling reagent. It suppresses racemization that can otherwise occur during the reaction...

"Melanocortin peptide therapeutics: historical milestones, clinical studies and commercialization". Peptides. 27 (4): 921–30. doi:10.1016/j.peptides.2005.01...

9-1 is a 29-amino acid peptide toxin derived from the venom of the sea anemone Urticina grebelnyi. The structure of the peptide is also referred to as...

Echinomycin is a peptide antibiotic. It is a dimer of two peptides creating a cyclic structure. It contains a bicyclic aromatic chromophore that is attached...

Glucagon-like peptide 1 receptor Glucagon-like peptide 2 receptor Gastric inhibitory polypeptide receptor The first three receptors bind closely related peptide hormones...

alpha 3 (DEFA3) also known as human alpha defensin 3, human neutrophil peptide 3 (HNP-3) or neutrophil defensin 3 is a human protein that is encoded by...

the tanning process used to turn skin into leather. The development of peptide mass fingerprinting permitted conclusive testing and became the gold standard...

"C-peptide - Creative Peptides -". AdisInsight. Retrieved 22 October 2016. "C-peptide – Eli Lilly". AdisInsight. Retrieved 22 October 2016. "C-peptide long-acting...

the transport of antigenic peptides across the endoplasmic reticulum membrane. This interaction facilitates optimal peptide loading on the MHC class I...

reactions is a vital part of life as it is essential to the formation of peptide bonds between amino acids and to the biosynthesis of fatty acids. Many...

interaction involving quorum sensing with the leaderless peptide signal speB-inducing peptide (SIP) acting in conjunction with a pH sensitive histidine...

Immunosignaturing is a medical diagnostic test which uses arrays of random-sequence peptides to associate antibodies in a blood sample with a disease. Early immunosignature...

duodenum, trypsin catalyzes the hydrolysis of peptide bonds, breaking down proteins into smaller peptides. The peptide products are then further hydrolyzed into...

Rindopepimut (CDX-110) is an injectable peptide cancer vaccine which targets a mutant protein called EGFRvIII present in about 25% to 30% of glioblastoma...

Calcitonin is a 32 amino acid peptide hormone secreted by parafollicular cells (also known as C cells) of the thyroid (or endostyle) in humans and other...

opioid growth factor (OGF), is a naturally occurring, endogenous opioid peptide that has opioid effects of a relatively short duration. It is one of the...

Peptide methionine sulfoxide reductase may refer to: Protein-methionine-S-oxide reductase Peptide-methionine (S)-S-oxide reductase This set index page...

Relcovaptan (SR-49059) is a non-peptide vasopressin receptor antagonist, selective for the V1A subtype. It has shown positive initial results for the...

folded amyloid beta (Aβ) protein in the brain. Amyloid beta is a short peptide that is an abnormal proteolytic byproduct of the transmembrane protein...

receptor (also known as the ghrelin receptor), where growth hormone-releasing peptides act to release growth hormone. This gene, expressed in the pituitary, encodes...

short reflexes from the enteric nervous system (ENS) and reflexes from GI peptides working in harmony with each other. Long reflexes to the digestive system...

techniques and instruments for peptide synthesis near the start of his career. He developed the multiple-column synthesis used in peptide and organic synthesis...

The contryphans (conus + tryptophan) are a family of peptides that are active constituents of the potent venom produced by cone snail (genus Conus). The...

A protein mimetic is a molecule such as a peptide, a modified peptide or any other molecule that biologically mimics the action or activity of some other...

antibiotic resistance can be expected to develop and affect human health. A peptide that prevents and treats citrus greening disease in greenhouse trials was...