SLC25A23

SLC25A23
Ідентифікатори
Символи SLC25A23, APC2, MCSC2, SCaMC-3, solute carrier family 25 member 23, SCAMC3
Зовнішні ІД OMIM: 608746 MGI: 1914222 HomoloGene: 11467 GeneCards: SLC25A23
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_024103
NM_025877
NM_001379067
NM_001379068
NM_001379069
NM_001379070
RefSeq (білок)
NP_077008
NP_080153
NP_001365996
NP_001365997
NP_001365999
NP_001365998
Локус (UCSC) Хр. 19: 6.44 – 6.47 Mb Хр. 17: 57.35 – 57.37 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SLC25A23 (англ. Solute carrier family 25 member 23) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 468 амінокислот, а молекулярна маса — 52 378[4].

Послідовність амінокислот
1020304050
MRGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGA
QQGISSEGDADPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVS
EIQQSFRALGISISLEQAEKILHSMDRDGTMTIDWQEWRDHFLLHSLENV
EDVLYFWKHSTVLDIGECLTVPDEFSKQEKLTGMWWKQLVAGAVAGAVSR
TGTAPLDRLKVFMQVHASKTNRLNILGGLRSMVLEGGIRSLWRGNGINVL
KIAPESAIKFMAYEQIKRAILGQQETLHVQERFVAGSLAGATAQTIIYPM
EVLKTRLTLRRTGQYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAG
IDLAVYETLKNWWLQQYSHDSADPGILVLLACGTISSTCGQIASYPLALV
RTRMQAQASIEGGPQLSMLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVS
ISYVVYENMKQALGVTSR

Задіяний у таких біологічних процесах, як транспорт, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном кальцію. Локалізований у мембрані, мітохондрії, внутрішній мембрані мітохондрії.

Література

  • del Arco A., Satrustegui J. (2004). Identification of a novel human subfamily of mitochondrial carriers with calcium-binding domains. J. Biol. Chem. 279: 24701—24713. PMID 15054102 DOI:10.1074/jbc.M401417200
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Del Arco A. (2005). Novel variants of human SCaMC-3, an isoform of the ATP-Mg/P(i) mitochondrial carrier, generated by alternative splicing from 3'-flanking transposable elements. Biochem. J. 389: 647—655. PMID 15801905 DOI:10.1042/BJ20050283

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:19375 (англ.) . Процитовано 21 вересня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, Q9BV35 (англ.) . Архів оригіналу за 31 липня 2017. Процитовано 21 вересня 2017.

Див. також

Read other articles:

Йозеф Харпенем. Josef Harpe Дата рождения 21 сентября 1887(1887-09-21) Место рождения Бюр (пригород Гельзенкирхена), Вестфалия, Германская империя Дата смерти 14 марта 1968(1968-03-14) (80 лет) Место смерти Нюрнберг, ФРГ Принадлежность Германская империя Веймарская республика Третий рей

Рябина домашняя Научная классификация Домен:ЭукариотыЦарство:РастенияКлада:Цветковые растенияКлада:ЭвдикотыКлада:СуперрозидыКлада:РозидыКлада:ФабидыПорядок:РозоцветныеСемейство:РозовыеПодсемейство:СливовыеТриба:ЯблоневыеРод:РябинаВид:Рябина домашняя Междунар�...

Physics and Chemistry of Liquidsангл. Physics and Chemistry of Liquids[1] Країна видання  США[1]Тематика хіміяМова англійська[1]Видавець Taylor & FrancisЗасновано 1968ISSN 0031-9104 (друковане видання)1029-0451 (інтернет-публікація[d])1026-7727 (оптичний диск), 0031-9104OCLC 50516984 tandfonline.com/toc/gpch20/current​(англ.)gbhap-us...

Taiwanese business executive and politician Eric WuWu Tung-sheng吳東昇Wu during his tenure on the Fifth Legislative YuanMember of the Legislative YuanIn office1 February 2002 – 31 January 2005ConstituencyRepublic of ChinaIn office1 February 1993 – 31 January 1996ConstituencyHsinchu CountyMember of the National AssemblyIn office20 May 1996 – 19 May 2000 Personal detailsBorn (1953-07-14) 14 July 1953 (age 70)Taipei, TaiwanNationalityRepublic of ChinaPoli...

العلاقات البنينية الصربية بنين صربيا   بنين   صربيا تعديل مصدري - تعديل   العلاقات البنينية الصربية هي العلاقات الثنائية التي تجمع بين بنين وصربيا.[1][2][3][4][5] مقارنة بين البلدين هذه مقارنة عامة ومرجعية للدولتين: وجه المقارنة بنين صربيا المساح

РозлученняDivorce Тип ситкомТелеканал(и) HBOДистриб'ютор(и) Hulu і HBO Max[d]Жанр КомедіяФормат зображення 1080i (HDTV)Тривалість серії 30 хв.Компанія Pretty Matches ProductionsMerman FilmsKapital Entertainment343 IncorporatedКерівник проєкту Sharon HorgandРежисер Шерон ХорганВиконавчий продюсер Шерон ХорганПол Сі

Indian singer and lyricist Prem Dhillon2020Background informationBirth namePremjeet Singh DhillonBorn (1995-01-04) 4 January 1995 (age 28)[1]Amritsar, Punjab, IndiaOriginPunjab, IndiaGenres Punjabi Bhangra pop Hip hop Occupation(s) Singer songwriter Instrument(s)VocalsYears active2018–presentLabelsSidhu Moose Wala • Thug Life Records • Speed RecordsWebsitePrem Dhillon on InstagramMusical artist Premjeet Singh Prem Dhillon is an Indian singer and songwriter associated with P...

Participation since 2003:   Entered at least once   Never entered, although eligible to do so   Entry intended, but later withdrew   Competed as a part of another country, but never as a sovereign state[a] Map showing each country's number of Junior Eurovision Song Contest wins Graph showing the number of countries in each contest from 2003 to 2022. A total of 41 countries have participated in the Junior Eurovision Song Contest since the first e...

Cacat dalam KandunganSutradara Fritz G. Schadt Produser Laurentius Yap Ditulis oleh P. Winarto PemeranBoy TirayohDona ArthaRuth PelupessyAde IrawanPong HardjatmoRatmi B29KuntjungPipit SandraDistributorArta Cata FilmTanggal rilis1977Durasi101 menitNegara Indonesia Bahasa Indonesia Cacat dalam Kandungan adalah film Indonesia yang dirilis pada tahun 1977 dengan disutradarai oleh Fritz G. Schadt. Film ini dibintangi antara lain oleh Boy Tirayoh dan Dona Artha. Sinopsis Andi dikenal sebagai pemuda...

City in Texas, United StatesVega, TexasCityDowntown VegaLocation of Vega, TexasCoordinates: 35°14′44″N 102°25′30″W / 35.24556°N 102.42500°W / 35.24556; -102.42500CountryUnited StatesStateTexasCountyOldhamArea[1] • Total1.34 sq mi (3.47 km2) • Land1.34 sq mi (3.47 km2) • Water0.00 sq mi (0.00 km2)Elevation[2]4,029 ft (1,228 m)Population (2010) ...

This article is about the fourth single released by Sa-Fire. For the Singaporean television series, see Gonna Make It (TV series). 1989 single by Sa-FireGonna Make ItSingle by Sa-Firefrom the album Sa-Fire Released1989GenreDance-pop, FreestyleLength4:56 (album version)LabelMercurySongwriter(s)David HarrisProducer(s)Angelo Cosme, Aldo Marin,Albert CabreraSa-Fire singles chronology Thinking of You (1989) Gonna Make It (1989) I Will Survive (1989) Gonna Make It is the fourth single released by f...

Tuality Hospital/SE 8th AveMAX Light Rail stationGeneral informationLocationSE Washington St at SE 8th AveHillsboro, OregonUSACoordinates45°31′17″N 122°58′42″W / 45.521302°N 122.978347°W / 45.521302; -122.978347Owned byTriMetPlatforms1 island platformTracks2ConstructionParking85 spaces in the Hillsboro Intermodal Transit Facility[1]HistoryOpenedSeptember 12, 1998Services Preceding station TriMet Following station Hillsboro Central/​Southeast 3rd A...

American pizzeria featured in The Sopranos For the former UK pizzeria chain, see Pizzaland. Pizza LandThe business in 2021.TypePrivateIndustryRestaurants, Food DeliveryFounded1965; 58 years ago (1965)HeadquartersNorth Arlington, New Jersey, United StatesProductsPizzaOwnerEddie Twdroos Pizza Land (spelled Pizzaland on its front sign and in press accounts, and as two words on a separate sign) is an American pizzeria at 260 Belleville Turnpike in North Arlington, New Jersey, wh...

2023 Slovak drama film PhotophobiaPromotional release posterDirected byIvan Ostrochovský [fr] Pavol PekarčíkWritten byIvan Ostrochovský Pavol PekarčíkProduced by Ivan Ostrochovský Albert Malinovský Katarína Tomková Tomáš Michálek Kristýna Michálek Květová StarringNikita TyshchenkoCinematographyIvan Ostrochovský Pavol PekarčíkEdited byIvan Ostrochovský Pavol Pekarčík Martin PigaMusic byRoman Kurhan Michal NovinskiRelease date September 1, 2023 ...

River in Wiltshire, England River EbbleRiver Ebble at Coombe BissetLocationCountryEnglandRegionWest of EnglandDistrictWiltshirePhysical characteristicsSource  • locationAlvediston, Wiltshire, England • coordinates51°00′46″N 2°02′20″W / 51.0127°N 2.039°W / 51.0127; -2.039 MouthRiver Avon (Hampshire) • coordinates51°02′00″N 1°45′30″W / 51.0334°N 1.7582°W / 51.0334; -...

Historic cemetery in Boone County, Missouri United States historic placeColumbia CemeteryU.S. National Register of Historic Places Show map of MissouriShow map of the United StatesLocation30 East Broadway, Columbia, MissouriCoordinates38°56′57″N 92°20′14″W / 38.94917°N 92.33722°W / 38.94917; -92.33722Area26 acres (11 ha)Built1820 (1820)ArchitectMajor, Horace F.,Architectural styleRomanesque, rural cemeteryNRHP reference No.06001335&...

Hoàng Thụ Hiền黄树贤Bộ trưởng Bộ Dân chính Trung QuốcNhiệm kỳ7 tháng 11 năm 2016 – 26 tháng 10 năm 20192 năm, 353 ngàyTiền nhiệmLý Lập QuốcKế nhiệmLý Kỉ HằngBộ trưởng Bộ Giám sát Trung QuốcNhiệm kỳ16 tháng 3 năm 2013 – 7 tháng 11 năm 20163 năm, 236 ngàyTiền nhiệmMã ÔnKế nhiệmDương Hiểu ĐộPhó Bí thư Ủy ban Kiểm tra Kỷ luật Trung ương Đảng Cộng sản T...

Professional wrestling stable Professional wrestling stable Main Event MafiaBooker T (left), Sharmell (next to Booker), Nash (back left), Sting (center) and Steiner (right)StableMembersSee belowName(s)Main Event MafiaDebutOctober 23, 2008 (original incarnation)June 13, 2013 (second incarnation)DisbandedOctober 22, 2009 (original incarnation)November 7, 2013 (second incarnation)Years active2008–2009, 2013 The Main Event Mafia was an American professional wrestling stable in the American prom...

British Pakistani cricketer Hamza AliPersonal informationFull nameHamza Sultan AliBorn(1995-08-05)5 August 1995Bristol, EnglandDied9 June 2016(2016-06-09) (aged 20)Bristol, EnglandBattingRight-handedBowlingRight-arm medium-fastDomestic team information YearsTeam2015–2016Rawalpindi Rams2016Hampshire Only First-class4 April 2016 Hampshire v Cardiff MCCUList A debut19 January 2015 Rawalpindi v National BankLast List A22 January 2016 Rawalpindi v FATACare...

Johann Strauss II Das Spitzentuch der Königin (The Queen's Lace Handkerchief) is an operetta by Johann Strauss II. The libretto by Heinrich Bohrmann-Riegen and Richard Genée was based on the Spanish writer Cervantes.[1] It was first performed on 1 October 1880 in Vienna at the Theater an der Wien under the composer's direction by Therese Braunecker-Schäfer, Alexander Girardi, Eugenie Erdösy, Karoline Tellheim, Hermine Meyerhoff, Felix Schweighofer and Ferdinand Schütz.[2]...