RPS19BP1

RPS19BP1
Ідентифікатори
Символи RPS19BP1, AROS, S19BP, dJ1104E15.4, ribosomal protein S19 binding protein 1
Зовнішні ІД OMIM: 610225 MGI: 1913788 HomoloGene: 18407 GeneCards: RPS19BP1
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_194326
NM_175109
RefSeq (білок)
NP_919307
NP_919307.1
NP_780318
Локус (UCSC) н/д Хр. 15: 80.14 – 80.15 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

RPS19BP1 (англ. Ribosomal protein S19 binding protein 1) – білок, який кодується однойменним геном, розташованим у людей на довгому плечі 22-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 136 амінокислот, а молекулярна маса — 15 434[4].

Послідовність амінокислот
1020304050
MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNS
AKGKVPKSALDEYRKRECRDHLRVNLKFLTRTRSTVAESVSQQILRQNRG
RKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS

Кодований геном білок за функцією належить до фосфопротеїнів. Локалізований у ядрі.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Kim E.-J., Kho J.-H., Kang M.-R., Um S.-J. (2007). Active regulator of SIRT1 cooperates with SIRT1 and facilitates suppression of p53 activity. Mol. Cell. 28: 277—290. PMID 17964266 DOI:10.1016/j.molcel.2007.08.030
  • Kim E.-J., Kho J.-H., Kang M.-R., Um S.-J. (2007). Mol. Cell. 28: 513—513. {{cite journal}}: Пропущений або порожній |title= (довідка)

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:28749 (англ.) . Процитовано 21 вересня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, Q86WX3 (англ.) . Архів оригіналу за 9 серпня 2017. Процитовано 21 вересня 2017.

Див. також

Read other articles:

Artikel ini perlu diwikifikasi agar memenuhi standar kualitas Wikipedia. Anda dapat memberikan bantuan berupa penambahan pranala dalam, atau dengan merapikan tata letak dari artikel ini. Untuk keterangan lebih lanjut, klik [tampil] di bagian kanan. Mengganti markah HTML dengan markah wiki bila dimungkinkan. Tambahkan pranala wiki. Bila dirasa perlu, buatlah pautan ke artikel wiki lainnya dengan cara menambahkan [[ dan ]] pada kata yang bersangkutan (lihat WP:LINK untuk keterangan lebih lanjut...

Изображение было скопировано с wikipedia:en. Оригинальное описание содержало: Summary Обґрунтування добропорядного використання для статті «Uncle Meat» [?] Опис Обкладинка  «Uncle Meat», виконавець The Mothers of Invention. Вважається, що авторське право на обкладинку належить лейблу, Biz...

Burg Wildberg Schloss Wildberg um 1674, Stich von G.M.Vischer Schloss Wildberg um 1674, Stich von G.M.Vischer Alternativname(n) Schloss Wildberg, Burgruine Wildberg Staat Österreich Ort Kirchschlag bei Linz Entstehungszeit 12.–15. Jahrhundert Burgentyp Höhenburg Erhaltungszustand Erhalten, teilweise Ruine Geographische Lage 48° 24′ N, 14° 18′ O48.40277777777814.294722222222Koordinaten: 48° 24′ 10″ N, 14° 17′ 41″ O Burg...

هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (يوليو 2019) تيم دوناهو   معلومات شخصية الميلاد 8 يونيو 1870  الوفاة 12 يونيو 1902 (32 سنة)   تونتون  مواطنة الولايات المتحدة  الحياة العملية المهنة لاعب كرة قاعدة ...

Hudson Hawk - Il mago del furtoEddie Hudson Hawk Hawkins (Bruce Willis) in una scena del filmTitolo originaleHudson Hawk Lingua originaleinglese Paese di produzioneStati Uniti d'America Anno1991 Durata100 min Rapporto1,85:1 Generecommedia, azione RegiaMichael Lehmann SoggettoRobert Kraft, Bruce Willis SceneggiaturaSteven E. de Souza, Daniel Waters ProduttoreJoel Silver Produttore esecutivoRobert Kraft Casa di produzioneTriStar Pictures FotografiaDante Spinotti MontaggioChris Lebenzon, Mic...

El Galpón Ciudad y municipio El GalpónLocalización de El Galpón en Provincia de SaltaCoordenadas 25°23′00″S 64°39′05″O / -25.383333333333, -64.651505555556Entidad Ciudad y municipio • País  Argentina • Provincia  Salta • Departamento MetánIntendente Federico Sacca. FpVEventos históricos   • Fundación 16 de mayo de 1899Altitud   • Media 508 m s. n. m.Población (2010)   • Total 8765 h...

Vorwärtsfehlerkorrektur (von englisch forward error correction, kurz FEC; manchmal auch engl. error detection and correction, kurz EDAC) ist eine Technik, die dazu dient, die Fehlerrate bei der Speicherung oder der Übertragung digitaler Daten zu senken, und stellt ein Fehlerkorrekturverfahren dar. Wenn in einem Übertragungssystem Vorwärtsfehlerkorrektur eingesetzt wird, kodiert der Sender die zu übertragenden Daten in redundanter Weise, so dass der Empfänger Übertragungsfehler ohne Rü...

Thomas Strakosha Strakosha bermain untuk Lazio pada April 2018Informasi pribadiNama lengkap Thomas Fotaq StrakoshaTanggal lahir 19 Maret 1995 (umur 28)Tempat lahir Athena, YunaniTinggi 193 cm (6 ft 4 in)Posisi bermain Penjaga gawangInformasi klubKlub saat ini BrentfordKarier junior2011–2012 Panionios2012–2014 LazioKarier senior*Tahun Tim Tampil (Gol)2014–2022 Lazio 164 (0)2015–2016 → Salernitana (pinjaman) 11 (0)2022– Brentford 0 (0)Tim nasional‡2012 Albania ...

Proportion of Americans living below the poverty line in each county of the fifty states, the District of Columbia, and Puerto Rico according to the 2016–2020 American Community Survey Number in Poverty and Poverty Rate: 1959 to 2017. The US. In the United States, poverty has both social and political implications. In 2020, there were 37.2 million people in poverty.[1] Some of the many causes include income inequality,[needs update][2] inflation, unemployment, debt t...

Wakil Bupati BuruPetahanaTidak adasejak 24 Mei 2022Masa jabatan5 tahunDibentuk2002Pejabat pertamaBakri LumbessySitus webburukab.go.id Berikut ini adalah daftar Wakil Bupati Buru dari masa ke masa. No Wakil Bupati Mulai Jabatan Akhir Jabatan Prd. Ket. Bupati 1 Bakri Lumbessy 2002 2007 1   Drs. H. M.Husnie Hentihu 2 Ramly Ibrahim UmasugiS.Pi., M.M. 2 Februari 2007 2 Februari 2012 2   3 Ir.Juhana Soedradjat 2 Februari 2012 28 Oktober 2016 3 [Ket. 1] Ramly Ibrahim UmasugiS....

بريمر فولكان     تاريخ التأسيس 23 أكتوبر 1893  الدولة ألمانيا  المقر الرئيسي بريمن-فيجيزاك،  وبريمن  الشركات التابعة شيتشاو سيبيكفيرت  الصناعة بناء السفن  المنتجات الغواصة الألمانية يو-292[1][2]،  والغواصة الألمانية يو-293[3][2]،  والغواصة ا...

Soviet Armenian politician and statesman (1897–1938) Gevork AlikhanyanHead of the Cadre Department of the Executive Committee of Communist InternationalIn office1935–1937First Secretary of the Communist Party of ArmeniaIn officeDecember 31, 1920–April 1921Preceded byposition createdSucceeded byAskanaz Mravyan Personal detailsBornGevork Sarkisovich Alikhanyan1897Tiflis, Tiflis Governorate, Russian Empire (now Tbilisi, Georgia)DiedFebruary 13, 1938 (aged 40-41)Kommunarka Shooting Ground, ...

Totem dan Tabu Totem and Taboo Sampul edisi pertamaPengarangSigmund FreudJudul asliTotem und Tabu: Einige Übereinstimmungen im Seelenleben der Wilden und der NeurotikerPenerjemahAbraham BrillJames StracheyBahasaJermanSubjekTotemismePenerbitBeacon PressTanggal terbit1913Jenis mediaCetakTeksTotem dan Tabu Totem and Taboo di Wikisource Totem dan Tabu, Totem and Taboo: Resemblances Between the Mental Lives of Savages and Neurotics, atau Totem and Taboo: Some Points of Agreement be...

Medical conditionBethlem myopathyOther namesMuscular dystrophy, limb-girdle, autosomal dominant 5, (LGMDD5); Ehlers–Danlos syndrome, myopathic type (EDSMYP)Bethlem myopathy has an autosomal dominant pattern of inheritance (autosomal recessive form exists as well[1]). Bethlem myopathy is predominantly an autosomal dominant myopathy, classified as a congenital form of muscular dystrophy. There are two types of Bethlem myopathy, based on which type of collagen is affected.[2] B...

Type of pottery from 7th century BC Trozzella, 4th century BC from Apulia Messapian pottery is a type of Messapian ceramic, produced between the 7th century BC until the 3rd century BC on the Italian region of southern Apulia. Messapian pottery was made by the Messapii, an ancient people inhabiting the heel of Italy since around 1000 BC, who migrated from Crete and Illyria. Messapian pottery consisted first primarily, with geometric patterns like circles, squares, diamonds, horizontal dash pa...

Airport terminal at London Heathrow Airport Heathrow Terminal 4Aerial view of terminal 4 during its use by British AirwaysLocation within Greater LondonGeneral informationTypeAirport terminalAddressStratford Road, Hounslow, LondonCoordinates51°27′34″N 0°26′49″W / 51.459455°N 0.446953°W / 51.459455; -0.446953Current tenantsSkyTeam allianceInaugurated1 April 1986Renovated2009-2017Cost£200 millionTechnical detailsFloor area105,481 square metres (1,135,39...

Fictitious character in eponymous American TV detective crime drama series Lieutenant Columbo and Frank Columbo redirect here. For the series itself, see Columbo. For other uses, see Columbo (disambiguation). This article describes a work or element of fiction in a primarily in-universe style. Please help rewrite it to explain the fiction more clearly and provide non-fictional perspective. (October 2019) (Learn how and when to remove this template message) Fictional character ColumboColumbo c...

Former South African university (1967–2004), now incorporated into University of Johannesburg 26°11′05″S 27°59′51″E / 26.18472°S 27.99750°E / -26.18472; 27.99750 Rand Afrikaans UniversityRandse Afrikaanse UniversiteitTypePublic universityActive24 February 1968–2004[1]LocationJohannesburg, Gauteng, South AfricaLanguageAfrikaans, EnglishColorsGreen and Grey     The Rand Afrikaans University (Afrikaans: Randse Afrikaanse Universiteit) was...

Work by Archimedes Psammites redirects here. For other uses, see Psammite. This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: The Sand Reckoner – news · newspapers · books · scholar · JSTOR (August 2021) (Learn how and when to remove this template message) The Sand Reckoner (Arenarius) AuthorArchimedesLanguageL...

1979 film by Joan Micklin Silver Chilly Scenes of WinterTheatrical release posterDirected byJoan Micklin SilverScreenplay byJoan Micklin SilverBased onChilly Scenes of Winterby Ann BeattieProduced by Mark Metcalf Amy Robinson Griffin Dunne Starring John Heard Mary Beth Hurt Peter Riegert Kenneth McMillan Gloria Grahame CinematographyBobby ByrneEdited byCynthia ScheiderMusic byKen LauberProductioncompanyTriple Play ProductionsDistributed byUnited ArtistsRelease date October 19, 1979&...