EIF4A3

EIF4A3
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи EIF4A3, DDX48, MUK34, NMP265, NUK34, RCPS, eIF4AIII, eukaryotic translation initiation factor 4A3, Fal1, eIF4A-III, eIF-4A-III
Зовнішні ІД OMIM: 608546 MGI: 1923731 HomoloGene: 5602 GeneCards: EIF4A3
Пов'язані генетичні захворювання
Richieri Costa-Pereira syndrome[1]
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_014740
NM_138669
RefSeq (білок)
NP_055555
NP_619610
Локус (UCSC) Хр. 17: 80.13 – 80.15 Mb Хр. 11: 119.18 – 119.19 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

EIF4A3 (англ. Eukaryotic translation initiation factor 4A3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 411 амінокислот, а молекулярна маса — 46 871[5].

Послідовність амінокислот
1020304050
MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLL
RGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCL
DIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDI
RKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQ
IYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEG
IKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREA
NFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLII
NYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQI
DEMPMNVADLI

Кодований геном білок за функціями належить до гідролаз, геліказ. Задіяний у таких біологічних процесах як регуляція трансляції, процесінг мРНК, сплайсінг мРНК, транспорт, процесинг рРНК, транспорт мРНК. Білок має сайт для зв'язування з АТФ, нуклеотидами, РНК. Локалізований у цитоплазмі, ядрі.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Jurica M.S., Licklider L.J., Gygi S.P., Grigorieff N., Moore M.J. (2002). Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis. RNA. 8: 426—439. PMID 11991638 DOI:10.1017/S1355838202021088
  • Shibuya T., Tange T.O., Sonenberg N., Moore M.J. (2004). eIF4AIII binds spliced mRNA in the exon junction complex and is essential for nonsense-mediated decay. Nat. Struct. Mol. Biol. 11: 346—351. PMID 15034551 DOI:10.1038/nsmb750
  • Simmons H.M., Ruis B.L., Kapoor M., Hudacek A.W., Conklin K.F. (2005). Identification of NOM1, a nucleolar, eIF4A binding protein encoded within the chromosome 7q36 breakpoint region targeted in cases of pediatric acute myeloid leukemia. Gene. 347: 137—145. PMID 15715967 DOI:10.1016/j.gene.2004.12.027
  • Tange T.O., Shibuya T., Jurica M.S., Moore M.J. (2005). Biochemical analysis of the EJC reveals two new factors and a stable tetrameric protein core. RNA. 11: 1869—1883. PMID 16314458 DOI:10.1261/rna.2155905
  • Shibuya T., Tange T.O., Stroupe M.E., Moore M.J. (2006). Mutational analysis of human eIF4AIII identifies regions necessary for exon junction complex formation and nonsense-mediated mRNA decay. RNA. 12: 360—374. PMID 16495234 DOI:10.1261/rna.2190706

Примітки

  1. Захворювання, генетично пов'язані з EIF4A3 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:18683 (англ.) . Архів оригіналу за 10 вересня 2015. Процитовано 28 лютого 2017.
  5. UniProt, P38919 (англ.) . Архів оригіналу за 24 березня 2017. Процитовано 28 лютого 2017.

Див. також

Read other articles:

هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (أغسطس 2013) الضرورة الزائفة، أو «نظرية مناهضة الجبرية الاجتماعية،»[بحاجة لمصدر] هي نظرية اجتماعية معاصرة تدعو إلى تكيفية التنظيمات الاجتماعية وقدرتها على التشكل بط

Picture cards that are collectable Not to be confused with Trade card. A trading card of football (soccer) star Diego Maradona issued for the 1986 FIFA World Cup A trading card (or collectible card) is a small card, usually made out of paperboard or thick paper, which usually contains an image of a certain person, place or thing (fictional or real) and a short description of the picture, along with other text (attacks, statistics, or trivia).[1] There is a wide variation of different ...

Wapen van de familie de Knyff De Knyff is een Zuid-Nederlandse adellijke familie. Geschiedenis In 1719 verleende keizer Karel VI, langs het onregelmatig kanaal van de keizerlijke kanselarij, de riddertitel van het Heilige Roomse Rijk aan Jacques Knyff. In 1734 werd de adellijke gunst aan Jacques Knyffe bevestigd, ditmaal door het regelmatige kanaal van de kanselarij in de Oostenrijkse Nederlanden. In 1756 verleende keizerin Maria Theresia de persoonlijke titel ridder aan twee zoons van Jacque...

Falkenberg Falkenberg Staat: Schweden Schweden Provinz (län): Hallands län Historische Provinz (landskap): Halland Gemeinde (kommun): Falkenberg Koordinaten: 56° 54′ N, 12° 30′ O56.90333333333312.491666666667Koordinaten: 56° 54′ N, 12° 30′ O SCB-Code: 3920 Status: Tätort Einwohner: 24.099 (31. Dezember 2015)[1] Fläche: 18,09 km²[1] Bevölkerungsdichte: 1332 Einwohner/km² Postleitzahl: 311 01

Сергій Карасьов Сергій Карасьов Особисті дані Повне ім'я Карасьов Сергій Геннадійович Народження 12 червня 1979(1979-06-12) (44 роки)   Москва, СРСР Громадянство  Росія Позиція захисник Інформація про клуб Поточний клуб завершив виступи Суддівська діяльність Громадянст

British Conservative politician This article is about the politician. For other uses, see Robin Walker (disambiguation). The HonourableRobin WalkerMPOfficial portrait, 2020Chair of the Education Select CommitteeIncumbentAssumed office 16 November 2022Preceded byRobert HalfonMinister of State for School StandardsIn office16 September 2021 – 6 July 2022Prime MinisterBoris JohnsonPreceded byNick GibbSucceeded byWill QuinceMinister of State for Northern Ireland[a]In office2...

Paul Natorp Paul Natrop (Paul Gerhard Natorp) (24 Januari 1854 – 17 Agustus 1924) adalah seorang pendidik dan filsuf dari Jerman.[1] Dia adalah seorang neo-Kantian yang bersekolah di Marburg.[1] Di sana dia menerapkan pandangan pada tafsir Plato dan metode keilmuwan.[1] Pada tahun 1910, dia menulis karya berjudul The Logical Basis of the Excact Sciences.[1] Dalam karyanya itu dia mempertimbangkan logika dan epistemologi yang dapat menjadi kebeba...

Retired Indian cricketer (born 1978) Virender SehwagSehwag in 2012Personal informationFull nameVirender SehwagBorn (1978-10-20) 20 October 1978 (age 45)Najafgarh, Delhi, IndiaNicknameViru, Nawab of Najafgarh, Sultan of MultanHeight5 ft 8 in (1.73 m)BattingRight-handedBowlingRight arm off breakRoleOpening batsmanInternational information National sideIndia (1999–2013)Test debut (cap 239)3 November 2001 v South AfricaLast Test2 March 2013 v...

British literary periodical The London MagazineCover of the issue For May, 1760.EditorSteven O'BrienCategoriesLiterary magazineFrequencyBimonthlyPublisherBurhan Al-ChalabiFounderIsaac KimberFounded1732CountryUnited KingdomBased inLondonLanguageEnglishWebsitewww.thelondonmagazine.orgISSN0024-6085 The London Magazine is the title of six different publications that have appeared in succession since 1732. All six have focused on the arts, literature and miscellaneous topics. 1732–1785 The Londo...

This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Welcome to Pia Carrot!! – news · newspapers · books · scholar · JSTOR (February 2010) (Learn how and when to remove this template message) Video game seriesWelcome to Pia Carrot!!Genre(s)Eroge, visual novelDeveloper(s)Cocktail Soft (home computers)KID (Saturn)S...

Judo at the 2015 Pan American Games – Women's 48 kg International sporting eventWomen's 48 kg at the 2015 Pan American GamesVenueMississauga Sports CentreDatesJuly 11Competitors10 from 10 nationsMedalists Dayaris Mestre Álvarez  Cuba Paula Pareto  Argentina Edna Carrillo  Mexico Nathalia Brigida  Brazil«2011 2019» Judo at the2015 Pan American GamesQualificationMenWomen60 kg48 kg66 kg52 kg73 kg57 kg81 kg63 kg90 kg7...

Часове кодування кубітів - це метод, яка використовується в квантовій інформатиці для кодування кубіта інформації на фотоні. Квантова інформатика використовує кубіти як основний ресурс, подібний до бітів у класичних обчисленнях. Кубіти - це будь-яка дворівнева квантово-...

This article is about the triathlon competition. For the sport utility vehicle, see Nissan Xterra. This article relies excessively on references to primary sources. Please improve this article by adding secondary or tertiary sources. Find sources: XTERRA Triathlon – news · newspapers · books · scholar · JSTOR (April 2009) (Learn how and when to remove this template message) XTERRA is a series of cross triathlon races, i.e. three-sport races which inclu...

Protected area in Norfolk Island, AustraliaNorfolk Island National ParkNorfolk IslandIUCN category II (national park) Captain Cook lookout within the Norfolk Island National ParkView southward to Phillip Island in the distance. In the foreground is the smaller Nepean Island.Norfolk Island National ParkNearest town or cityBurnt PineCoordinates29°04′S 167°56′E / 29.067°S 167.933°E / -29.067; 167.933Established1984 (1984)Area6.5 km2 (2.5 sq mi)...

Economic sectors Three-sector model Primary sector (raw materials) Secondary sector (manufacturing) Tertiary sector (services) Additional sectors Quaternary sector (information services) Quinary sector (human services) Theorists AGB Fisher Colin Clark Jean Fourastié Sectors by ownership Business sector Private sector Public sector Voluntary sector vte Economical term Percentages of a country's economy made up by different sectors. Countries with higher levels of socio-economic development te...

Marzio Bruseghin Datos personalesNacimiento Conegliano (Italia)15 de junio de 1974 (49 años)Carrera deportivaRepresentante de Italia ItaliaDeporte CiclismoDisciplina RutaTrayectoria Equipos profesionales 1997-19981999-20022003-20052006-20092010-2012 BrescialatBanestoFassa BortoloLampreCaisse d'Épargne/Movistar               Títulos Giro de Italia: 2 etapas [editar datos en Wikidata] Marzio Bruseghin (...

2014 studio album by We Are LeoFightback SoundtrackStudio album by We Are LeoReleasedOctober 14, 2014 (2014-10-14)GenreContemporary Christian music, electronica, pop rockLength43:41LabelDreamWe Are Leo chronology Hello Again(2012) Fightback Soundtrack(2014) Fightback Soundtrack is the second studio album by We Are Leo. Dream Records released the album on October 14, 2014. Critical reception Professional ratingsReview scoresSourceRating365 Days of Inspiring Media[1&#...

Jaime Fernández Fernández, en 1962.Información personalNombre de nacimiento Nicolás Jaime Fernández ReyesNacimiento 6 de diciembre de 1927Monterrey Nuevo León, MéxicoFallecimiento 15 de abril de 2005 (77 años)Ciudad de México, MéxicoCausa de muerte Infarto agudo de miocardio Nacionalidad MexicanaFamiliaCónyuge Corinne y GlendaHijos 4Familiares Fernando Fernández (medio hermano Agustín Fernández (medio hermano)Emilio Fernández (primo hermano)Información profesionalOcupaci�...

Fictional character and singer from The Simpsons franchise Fictional character Dr. HibbertThe Simpsons characterFirst appearanceBart the Daredevil (1990)Created byMatt GroeningDesigned byMatt GroeningVoiced byHarry Shearer (1990–2021)Kevin Michael Richardson (2021–present)[1]In-universe informationFull nameJulius Michael HibbertGenderMaleOccupationDoctor at Springfield General HospitalOwner at M.D. Family PracticeFamilyBleeding Gums Murphy (brother, implied)SpouseBernice Hibbert (...

Paghimo ni bot Lsjbot. Stropharia acanthocystis Siyentipikinhong Pagklasipikar Kaginharian: Fungi Kabahig: incertae sedis Ka-ulo: Basidiomycota Kahutong: Agaricomycetes Kahanay: Agaricales Kabanay: Hymenogastraceae Kahenera: 'Stropharia' Espesye: ''Stropharia acanthocystis'' Siyentipikinhong Ngalan Stropharia acanthocystisCortez & R. M. Silveira, 2007 Kaliwatan sa uhong ang Stropharia acanthocystis.[1] sakop sa ka-ulo nga Basidiomycota, ug Una ning gihulagway ni Cortez ug R. M. Si...