Earnest Williams was an African-American man who was lynched by a mob in Parkdale, Ashley County, Arkansas, in 1908. John R. Steelman, who wrote his PhD dissertation on "mob action in the South", listed Williams as one of the cases, and said "Earnest Williams was thrust into eternity by a band of men who were 'outraged' at him for 'using offensive language'."[1]
33°7′18″N 91°32′51″W / 33.12167°N 91.54750°W / 33.12167; -91.54750
1971 adventure film directed by Kevin Billington This article is about the film. For the Jules Verne novel, see The Lighthouse at the End of the World. The Light at the Edge of the WorldBrynner and others on the set of the filmDirected byKevin BillingtonWritten byTom RoweRachel Billington (additional dialogue)Based onThe Lighthouse at the End of the Worldby Jules VerneProduced byKirk DouglasexecutiveAlexander SalkindIlya SalkindAlfredo MatasStarringYul BrynnerKirk Douglas Samantha EggarFernando …
St Abb's Head National Nature ReserveIUCN category IV (habitat/species management area)[1]St Abb's Head seen from the south near the village of St AbbsLocation with the Scottish BordersShow map of Scottish BordersLocation in ScotlandShow map of ScotlandLocationScottish Borders, ScotlandCoordinates55°54′57.9″N 2°08′19.0″W / 55.916083°N 2.138611°W / 55.916083; -2.138611Area77.2 ha (191 acres)[2]DesignationNatureScotEstablished1984[1]…
БлекпулBlackpool герб Блекпул вночіБлекпул вночі Основні дані 53°49′ пн. ш. 3°03′ зх. д. / 53.817° пн. ш. 3.050° зх. д. / 53.817; -3.050Координати: 53°49′ пн. ш. 3°03′ зх. д. / 53.817° пн. ш. 3.050° зх. д. / 53.817; -3.050 Країна Велика БританіяРегіо
Ethnolinguistic group of the Philippines Banguingui redirects here. For the municipality, see Banguingui, Sulu. This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Banguingui people – news · newspapers · books · scholar · JSTOR (December 2008) (Learn how and when to remove this template message) BanguinguiTotal pop…
1991 studio album byIslandStudio album by HÖHCurrent 93ReleasedNovember 1991 (1991-11)Recorded1986–1991StudioStúdíó Sýrland [is]Hot IceLength1:00:20LanguageEnglishLabelDurtroProducerHÖH Island is a studio album by HÖH and Current 93, released in November 1991 through Durtro. It differs from much of Current 93's output due to its prominent use of synthesizers and ambient music. Some of the compositions also appear on HÖH's soundtrack for the film Children …
SchaerbeekSchaarbeek SchaerbeekSchaarbeek (Belgien) SchaerbeekSchaarbeek Staat: Belgien Belgien Region: Brüssel-Hauptstadt Provinz: (seit 01.01.1995 „entprovinzialisiert“) Bezirk: Brüssel-Hauptstadtwub Koordinaten: 50° 51′ N, 4° 22′ O50.8583333333334.3683333333333Koordinaten: 50° 51′ N, 4° 22′ O Fläche: 8,14 km² Einwohner: 130.690 (1. Jan. 2022) Bevölkerungsdichte: 16.055 Einwohner je km² Postleitzahl: 1030 Vorwahl: 02 Bürg…
This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Rugby shirt – news · newspapers · books · scholar · JSTOR (January 2018) (Learn how and when to remove this template message) URBA Rugby 2007 Finals in Argentina A rugby shirt, also known as a rugby jersey, is worn by players of rugby union or rugby league. It usu…
Ruling dynasty of Nepal (600–1200) Part of a series on the History of Nepal Etymology Timeline Urheimat Ancient Neolithic, c. 7600 – c. 3300 BCE Bronze Age, c. 3300 – c. 1200 BCE Iron Age, c. 1200 – c. 200 BCE Shakya Kingdom, c. 1st millennium BCE Nepal in Mahabharata Parvata Kingdom Nepa Kingdom Himalaya Kingdom Kirata Kingdom Khasas in Mahabharata Limbuwan tribal states c. 580 BCE – 1774 CE Videha Kingdom Gopala Dynasty Mahisapala dynasty Soma dynasty, c. 205 – c. 305 Classical L…
O experimento de Wu foi um experimento de física nuclear conduzido em 1956 pela física sino-americana Chien-Shiung Wu em colaboração com o Grupo de Baixas Temperaturas do National Bureau of Standards dos EUA.[1] O objetivo do experimento foi estabelecer se a conservação da paridade (P), que era previamente estabelecida nas interações eletromagnética e forte, também se aplicava às interações fracas. Se a conservação de paridade fosse verdadeira, todos os fenômenos e interações s…
Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of the C…
Cá mòi cờCá mòi cờ ở Việt NamPhân loại khoa họcGiới (regnum)AnimaliaNgành (phylum)ChordataLớp (class)ActinopterygiiBộ (ordo)ClupeiformesHọ (familia)ClupeidaeChi (genus)ClupanodonLacépède, 1803Loài (species)C. thrissaDanh pháp hai phầnClupanodon thrissa(Linnaeus, 1758) Cá mòi cờ hay còn gọi là cá mòi Trung Hoa (Danh pháp khoa học: Clupanodon thrissa) là một loài cá mòi phân bố ở châu Á như Ấn Độ, Trung Quốc, Triều Tiên, Nhật B…
Stasiun Angke C08 Emplasemen Stasiun Angke, 2022.LokasiJalan Stasiun AngkeAngke, Tambora, Jakarta Barat, 11330IndonesiaKoordinat6°08′39″S 106°48′02″E / 6.1442937°S 106.8006706°E / -6.1442937; 106.8006706Koordinat: 6°08′39″S 106°48′02″E / 6.1442937°S 106.8006706°E / -6.1442937; 106.8006706Ketinggian+3 mOperatorKAI CommuterLetak dari pangkal km 3+739 lintas Kampung Bandan–Angke km 2+063 lintas Angke–Tanah Abang–Rangkasbi…
American drug researcher Rick StrassmanBorn(1952-02-08)February 8, 1952Los Angeles, CaliforniaNationalityAmericanEducationPomona CollegeStanford UniversityAlma materAlbert Einstein College of MedicineKnown forDMT: The Spirit MoleculeScientific careerFieldsPsychiatryPsychedelics Rick Strassman is an American clinical associate professor of psychiatry at the University of New Mexico School of Medicine. He has held a fellowship in clinical psychopharmacology research at the University of …
Danish actor (1948–2018) Ole ThestrupOle Thestrup and Anette Støvelbæk in the Folketeatret production of Le PèreBorn(1948-03-12)12 March 1948Nibe, DenmarkDied2 February 2018(2018-02-02) (aged 69)Tuse Næs, DenmarkOccupationActorYears active1978–2017Ole Svane Thestrup (12 March 1948 – 2 February 2018) was a Danish actor. He appeared in many Danish films, particularly those directed by Anders Thomas Jensen, as well as television and theatre roles. He had a recurring role in the …
U.S. Army's center for addressing critical gaps in DoD medical research programs This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) This article contains content that is written like an advertisement. Please help improve it by removing promotional content and inappropriate external links, and by adding encyclopedic content written from a neutral point of view. (June 2018) (Learn how and when to…
Pemilihan umum legislatif Austria 201920172019183 kursi Dewan Nasional92 kursi untuk meraih status mayoritasJajak pendapat Kandidat Partai pertama Partai kedua Partai ketiga Ketua Sebastian Kurz Pamela Rendi-Wagner Norbert Hofer Partai ÖVP Partai Demokrasi Sosial Austria Partai Kebebasan Austria Ketua sejak 15 Mei 2017 25 September 2018 19 Mei 2019 Pemilu sebelumnya 62 kursi, 31,5% 52 kursi, 26.9% 51 kursi, 26,0% Kursi yang dimenangkan 71 40 31 Perubahan&#…
Genus of lichen-forming fungi Platythecium Platythecium pyrrhochroum;scale bar = 1 mm Scientific classification Domain: Eukaryota Kingdom: Fungi Division: Ascomycota Class: Lecanoromycetes Order: Graphidales Family: Graphidaceae Genus: PlatytheciumStaiger (2002) Type species Platythecium grammitis(Fée) Staiger (2002) Platythecium is a genus of lichen-forming fungi in the family Graphidaceae. It contains an estimated 27 species.[1] Species Platythecium acutisporum Staiger (2002) Pla…
Найра (рус.)Naira (англ.) Naira (фр.) Нигерийские банкноты 2007 года Коды и символы Коды ISO 4217 NGN (566) Символы ₦ • N Аббревиатуры NGN Территория обращения Страна-эмитент Нигерия Производные и параллельные единицы Дробные кобо (1⁄100) Монеты и банкноты в обращении Монеты 50 ко…
This article includes a list of general references, but it lacks sufficient corresponding inline citations. Please help to improve this article by introducing more precise citations. (June 2014) (Learn how and when to remove this template message) Hospital in Hong Kong Island, Hong KongTung Wah Eastern HospitalHospital Authority and Tung Wah Group of HospitalsTung Wah Eastern Hospital entranceGeographyLocation19 Eastern Hospital Road, Causeway Bay, Hong Kong Island, Hong KongCoordinates22°16′…
U.S. Army military band 434th Army BandThe Signal Corps Band pictured in 2012Active1943 – 1946, 1950 – 2016Country United StatesBranch United States ArmyTypeMilitary bandRolePublic dutiesFinal postFort Gordon, GeorgiaNickname(s)Signal Corps BandEngagementsWorld War II[1] New Guinea Campaign Battle of Luzon DecorationsPhilippine Republic Presidential Unit Citation (1944)[1]InsigniaDistinctive unit insigniaMilitary unit The Signal Corps Band (officially the 434th Army…
Lokasi Pengunjung: 3.128.200.132