Share to: share facebook share twitter share wa share telegram print page

IL19

IL19
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи IL19, IL-10C, MDA1, NG.1, ZMDA1, Interleukin 19, IL-19
Зовнішні ІД OMIM: 605687 MGI: 1890472 HomoloGene: 17813 GeneCards: IL19
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_013371
NM_153758
NM_001369605
NM_001393490
NM_001393491
NM_001009940
NM_001355135
RefSeq (білок)
NP_037503
NP_715639
NP_001356534
NP_001009940
NP_001342064
Локус (UCSC) Хр. 1: 206.77 – 206.84 Mb Хр. 1: 130.86 – 130.87 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

IL19 (англ. Interleukin 19) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 177 амінокислот, а молекулярна маса — 20 452[4].

Послідовність амінокислот
1020304050
MKLQCVSLWLLGTILILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQA
KDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKI
LRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVH
AAAIKSLGELDVFLAWINKNHEVMFSA

Кодований геном білок за функцією належить до цитокінів. Задіяний у таких біологічних процесах як апоптоз, поліморфізм, альтернативний сплайсинг. Секретований назовні.

Література

  • Wang P., Yu P., Gao P., Shi T., Ma D. (2009). Discovery of novel human transcript variants by analysis of intronic single-block EST with polyadenylation site. BMC Genomics. 10: 518—518. PMID 19906316 DOI:10.1186/1471-2164-10-518
  • Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 13: 2819—2824. PMID 15340161 DOI:10.1110/ps.04682504

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:5990 (англ.) . Архів оригіналу за 26 березня 2016. Процитовано 28 серпня 2017.
  4. UniProt, Q9UHD0 (англ.) . Архів оригіналу за 16 листопада 2016. Процитовано 28 серпня 2017.

Див. також

Read other articles:

Escort carrier of the Imperial Japanese Navy Shin'yō in November 1943 History Empire of Japan NameShin'yō BuilderAG Weser Launched14 December 1934 Acquired1942 Commissioned15 November 1943 FateSunk, 17 November 1944 NotesConverted from the German liner Scharnhorst General characteristics Class and typeUnique escort carrier Displacement Standard: 17,500 t (17,200 long tons) Full load: 20,586 t (20,261 long tons) Length189.36 m (621 ft 3 in) Beam26 m (85 ft) Dr…

American college basketball season 1921–22 Wisconsin Badgers men's basketballConferenceBig Ten ConferenceRecord14–5 (8–4 Big Ten)Head coachWalter MeanwellHome arenaRed GymSeasons← 1920–211922–23 → 1921–22 Big Ten Conference men's basketball standings vte Conf Overall Team W   L   PCT W   L   PCT Purdue 8 – 1   .889 15 – 3   .833 Michigan 8 – 4   .667 15 – 4   .789 Wisconsin 8 – 4 …

Albert Kratzenberg Plaats uw zelfgemaakte foto hier Persoonsgegevens Geboren Clervaux, 8 april 1890 Overleden Clervaux, 23 mei 1966 Geboorteland Luxemburg Beroep(en) beeldhouwer Portaal    Kunst & Cultuur De man met de hamer (1939?), Dudelange Albert Kratzenberg (Clervaux, 8 april 1890 – aldaar, 23 mei 1966) was een Luxemburgs beeldhouwer.[1][2] Leven en werk Albert Kratzenberg was de jongste zoon van Henri Joseph Kratzenberg en Regina Koener.[3] Vader Kra…

Military forces of the Russian Federation Armed Forces of the Russian FederationВооружённые си́лы Росси́йской Федера́цииEmblem of the Russian Armed ForcesBanner of the Russian Armed ForcesFounded1721 (Imperial Russian Army)Current form7 May 1992Service branches Ground Forces Navy Aerospace Forces Strategic Rocket Forces Airborne Forces Special Operations ForcesHeadquartersMinistry of Defence, MoscowLeadershipSupreme Commander-in-Chief Vladimir Putin…

Карр'єр-су-ПуассіCarrières-sous-Poissy   Країна  Франція Регіон Іль-де-Франс  Департамент Івлін  Округ Сен-Жермен-ан-Ле Кантон Пуассі-Нор Код INSEE 78123 Поштові індекси 78955 Координати 48°56′55″ пн. ш. 2°02′22″ сх. д.H G O Висота 17 - 44 м.н.р.м. Площа 7,19 км² Населення 17 417 (01-2020 …

Hypothesis regarding theory of mind in autistic people Not to be confused with aphantasia, the inability to produce mental images. Mind-blindness, mindblindness or mind blindness is a theory initially proposed in 1990 that claims that all autistic people have a lack or developmental delay of theory of mind (ToM), meaning they are unable to attribute mental states to others.[1][2][3] According to some, a lack of ToM is considered equivalent to a lack of both cognitive and …

Untuk kegunaan lain, lihat Luminarie (disambiguasi). Penutup got di Festival Kobe Luminarie Kobe Luminarie (神戸ルミナリエcode: ja is deprecated ) adalah festival cahaya yang diadakan di Kobe, Jepang. Festival ini diadakan setiap bulan Desember yang dimulai sejak tahun 1995; dalam memperingati gempa bumi besar Hanshin pada tahun tersebut.[1] Pemerintah Italia menyumbang lampu-lampu yang digunakan pada festival ini; di mana instalasinya diproduksi oleh Valerio Festi[2] dan …

Rois et Reine Léda et le Cygne par Le Corrège, 1532 Données clés Réalisation Arnaud Desplechin Scénario Arnaud DesplechinRoger Bohbot Musique Grégoire Hetzel Acteurs principaux Emmanuelle DevosMathieu Amalric Catherine DeneuveMaurice Garrel Sociétés de production Why Not Productions Pays de production France Genre Comédie dramatique Durée 150 minutes Sortie 2004 Pour plus de détails, voir Fiche technique et Distribution Rois et Reine est un film français réalisé par Arnaud Desplec…

Australian water polo player Bronwen KnoxPersonal informationNickname(s)Bron, BronnieNationalityAustralianBorn (1986-04-16) 16 April 1986 (age 37)Brisbane, QueenslandHeight178 cm (5 ft 10 in)Weight100 kg (220 lb)SportCountryAustraliaSportWater poloCollege teamHartwick CollegeTeamOlympiacos WP Medal record Olympic Games 2008 Beijing Team competition 2012 London Team competition World Aquatics Championship 2007 Melbourne Team competition 2013 Barcelona Team competitio…

Country located primarily in Western Europe For other uses, see France (disambiguation), Lafrance, or (for prior French Republics) French Republics. This article may be too long to read and navigate comfortably. Its current readable prose size is 106 kilobytes. Please consider splitting content into sub-articles, condensing it, or adding subheadings. Please discuss this issue on the article's talk page. (June 2023) French RepublicRépublique française (French) Flag Coat of arms[I] …

20B redirects here. For the isotope of boron (20B), see Boron-20. This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Mazda Wankel engine – news · newspapers · books · scholar · JSTOR (January 2018) (Learn how and when to remove this template message) Reciprocating internal combustion engine Wankel rotary enginesOv…

The HonorableAl Francis Bichara22nd Governor of AlbayIn officeJune 30, 2016 – June 30, 2022Vice GovernorHarold ImperialEdcel Lagman Jr.Preceded byJoey SalcedaSucceeded byNoel RosalIn officeJune 30, 1995 – June 30, 2004Preceded byDanilo AzañaSucceeded byFernando V. GonzalezMember of the Philippine House of Representatives from Albay's 2nd congressional districtIn officeJune 30, 2007 – June 30, 2016Preceded byCarlos R. ImperialSucceeded byJoey SalcedaMember of…

Ejemplo de pirámide de una población en fase de envejecimiento (Francia). La pirámide registra también el incremento en la natalidad en el período posterior a la conclusión de la segunda guerra mundial (escalón de los 55 a 60 años). Un ejemplo de estructura demográfica por edad y sexo en un país y momento determinados. Estructura demográfica o una posible estructura de la población es la clasificación de la población en grupos determinados y según ciertos criterios, que permiten p…

WTA-toernooi van Columbus OH Officiële naam Tennis Ohio Championships Stad, land Columbus, OH, VS Locatie Tennis Ohio Auspiciën WTA Categorie WTA 125 Prijzengeld US$ 115.000 Deelnemers 32 enkel, 16 kwal. / 11 dubbel Ondergrond hardcourt, binnen Periode september Jaargangen 1978 - 1981, 2021 Titelhouder Nuria Párrizas Díaz Profiel Profiel op de WTA-site Website columbuschallenger.com Portaal    Tennis Het WTA-toernooi van Columbus OH is een jaarlijks terugkerend tennistoer…

Christoph und Lollo, 2010 ChartplatzierungenErklärung der Daten Alben[1] Tschuldigung   AT 20 11.03.2011 (3 Wo.) Das ist Rock ’n’ Roll   AT 17 17.10.2014 (2 Wo.) Mitten ins Hirn   AT 59 26.10.2018 (1 Wo.) Singles Karl-Heinz   AT 49 11.03.2011 (1 Wo.) Christoph Drexler und Lollo (Lorenz) Pichler sind ein Wiener Liedermacher-Duo. Auf der Gitarre oder am Klavier von Lollo begleitet, singt Christoph die von seinem Kollegen geschriebenen Lieder. Di…

Julia SzeluchinaJulia Szeluchina in 2011Personal informationNationalityUkrainianBorn (1979-04-30) April 30, 1979 (age 44)Height180 cm (5 ft 11 in)Volleyball informationNumber7 Szeluchina competed at the 2005 FIVB Volleyball Girls' U18 World Championship,[1] 2013 Women's European Volleyball Championship, and 2014 FIVB Volleyball Women's World Championship.[2] Szeluchina played for Monte Schiavo Banca Marche Jesi, Grot Budowlani Łódź, and Atom Trefl Sopot. …

County of Waldburg-TrauchburgGrafschaft Waldburg-Trauchburg1424–1772StatusState of the Holy Roman EmpireCommon languagesAlemannic GermanGovernmentPrincipalityHistorical eraMiddle Ages• Partitioned from Waldburg 1424• Partitioned, part to    Waldburg-Capustigall  1504• Partitioned, part to    Waldburg-Friedburg-Scheer  1612–1717• Partitioned, part to    Waldburg-Scheer  1717–64•…

Municipality in Rhineland-Palatinate, GermanyEhlenz MunicipalityLocation of Ehlenz within Eifelkreis Bitburg-Prüm district Ehlenz Show map of GermanyEhlenz Show map of Rhineland-PalatinateCoordinates: 50°02′29″N 06°28′16″E / 50.04139°N 6.47111°E / 50.04139; 6.47111CountryGermanyStateRhineland-PalatinateDistrictEifelkreis Bitburg-Prüm Municipal assoc.Bitburger LandGovernment • Mayor (2019–24) Erik Lichter[1]Area • Total5.…

الموارد الطبيعية في السعودية هي المخزونات الطبيعية من مصادر الطاقة والمعادن والثروات المائية والنباتية التي تتواجد بالسعودية، هذه الأخيرة تُعَدُّ بلدًا مغطى بكنوز ضخمة من هذه الموارد. وليست مجرد نفط كما يعتقد البعض. فهي تحتل المرتبة الثالثة عالميا في قائمة الدول الأكثر تو…

Town in Himachal Pradesh, India This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) This article may require cleanup to meet Wikipedia's quality standards. The specific problem is: Similar sections on tourism, blog-like writing style. Please help improve this article if you can. (August 2019) (Learn how and when to remove this template message) This article contains content that is written like …

Kembali kehalaman sebelumnya

Lokasi Pengunjung: 18.118.137.54