BIN1

BIN1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи BIN1, AMPH2, AMPHL, SH3P9, bridging integrator 1, CNM2
Зовнішні ІД OMIM: 601248 MGI: 108092 HomoloGene: 113707 GeneCards: BIN1
Пов'язані генетичні захворювання
хвороба Альцгеймера, centronuclear myopathy[1]
Шаблон експресії




Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001083334
NM_009668
NM_001360876
RefSeq (білок)
NP_001076803
NP_033798
NP_001347805
Локус (UCSC) Хр. 2: 127.05 – 127.11 Mb Хр. 18: 32.51 – 32.57 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

BIN1 (англ. Bridging integrator 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 593 амінокислот, а молекулярна маса — 64 699[5].

Послідовність амінокислот
1020304050
MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQN
FNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEA
NKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDY
DSARHHYESLQTAKKKDEAKIAKPVSLLEKAAPQWCQGKLQAHLVAQTNL
LRNQAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEE
NFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPP
DGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPS
KEVKQEQILSLFEDTFVPEISVTTPSQFEAPGPFSEQASLLDLDFDPLPP
VTSPVKAPTPSGQSIPWDLWEPTESPAGSLPSGEPSAAEGTFAVSWPSQT
AEPGPAQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPA
TVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVI
PFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP

Кодований геном білок за функціями належить до білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах як взаємодія хазяїн-вірус, ендоцитоз, диференціація, ацетиляція, альтернативний сплайсинг. Локалізований у цитоплазмі, ядрі.

Література

  • Ramjaun A.R., Micheva K.D., Bouchelet I., McPherson P.S. (1997). Identification and characterization of a nerve terminal-enriched amphiphysin isoform. J. Biol. Chem. 272: 16700—16706. PMID 9195986 DOI:10.1074/jbc.272.26.16700
  • Sakamuro D., Elliott K.J., Wechsler-Reya R., Prendergast G.C. (1996). BIN1 is a novel Myc-interacting protein with features of a tumour suppressor. Nat. Genet. 14: 69—76. PMID 8782822 DOI:10.1038/ng0996-69
  • Tsutsui K., Maeda Y., Tsutsui K., Seki S., Tokunaga A. (1997). cDNA cloning of a novel amphiphysin isoform and tissue-specific expression of its multiple splice variants. Biochem. Biophys. Res. Commun. 236: 178—183. PMID 9223448 DOI:10.1006/bbrc.1997.6927
  • Wechsler-Reya R.J., Sakamuro D., Zhang J., Duhadaway J., Prendergast G.C. (1997). Structural analysis of the human BIN1 gene. Evidence for tissue-specific transcriptional regulation and alternate RNA splicing. J. Biol. Chem. 272: 31453—31458. PMID 9395479 DOI:10.1074/jbc.272.50.31453
  • Wechsler-Reya R.J., Elliott K.J., Prendergast G.C. (1998). A role for the putative tumor suppressor Bin1 in muscle cell differentiation. Mol. Cell. Biol. 18: 566—575. PMID 9418903 DOI:10.1128/MCB.18.1.566
  • Ge K., Prendergast G.C. (2000). Bin2, a functionally nonredundant member of the BAR adaptor gene family. Genomics. 67: 210—220. PMID 10903846 DOI:10.1006/geno.2000.6216

Примітки

  1. Захворювання, генетично пов'язані з BIN1 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:1052 (англ.) . Процитовано 28 серпня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  5. UniProt, O00499 (англ.) . Архів оригіналу за 17 серпня 2017. Процитовано 28 серпня 2017.

Див. також

Read other articles:

تحتاج هذه المقالة إلى الاستشهاد بمصادر إضافية لتحسين وثوقيتها. فضلاً ساهم في تطوير هذه المقالة بإضافة استشهادات من مصادر موثوقة. من الممكن التشكيك بالمعلومات غير المنسوبة إلى مصدر وإزالتها. (ديسمبر 2022)   لمعانٍ أخرى، طالع ائتلاف (توضيح). الائتلاف أو التحالف[1] (بالإن

У Вікіпедії є статті про інші географічні об’єкти з назвою Беярд. Місто Беярдангл. Bayard Координати 41°45′29″ пн. ш. 103°19′29″ зх. д. / 41.75805555558377336° пн. ш. 103.32472222224778591° зх. д. / 41.75805555558377336; -103.32472222224778591Координати: 41°45′29″ пн. ш. 103°19′29″ зх. 

هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (مايو 2021) سفين شوير معلومات شخصية الميلاد 19 يناير 1971 (52 سنة)  بوبلينغين  الطول 1.87 م (6 قدم 1 1⁄2 بوصة) مركز اللعب حارس مرمى الجنسية ألمانيا  مسيرة الشباب

Archaeological culture of the Levant, dating to around 15,000 to 11,500 years ago Natufian cultureA map of the Levant with Natufian regions across present-day Israel, Palestine, Jordan, and a long arm extending into Lebanon and SyriaGeographical rangeLevant, Western AsiaPeriodEpipaleolithicDates15,000–11,500 BPType siteShuqba cave, in Wadi NatufMajor sitesShuqba cave, Ain Mallaha, Ein Gev, Tell Abu HureyraPreceded byKebaran, MushabianFollowed byNeolithic: Khiamian, Shepherd Neolithic The Na...

American academic (born 1936) Mimi Reisel GladsteinBorn1936 (1936)NicaraguaNationalityAmericanOther namesMiriam Reisel[1]EducationOklahoma University[1]University of New Mexico (Ph.D.)Occupation(s)Professor of English and Theatre ArtsEmployerUniversity of Texas at El Paso Mimi Reisel Gladstein (born 1936) is a professor of English and Theatre Arts at the University of Texas at El Paso. Her specialties include authors such as Ayn Rand and John Steinbeck, as well as wo...

This article uses bare URLs, which are uninformative and vulnerable to link rot. Please consider converting them to full citations to ensure the article remains verifiable and maintains a consistent citation style. Several templates and tools are available to assist in formatting, such as reFill (documentation) and Citation bot (documentation). (September 2022) (Learn how and when to remove this template message) First Baptist Church is a Baptist megachurch located in Panama City, Florida. It...

Distrik CDC Singapura Dewan Pengembangan Masyarakat (bahasa Inggris: Community Development Council, singkatan: CDC; Mandarin: 社区发展理事会; Melayu: Majlis Pembangunan Masyarakat; Tamil: சமூக மேம்பாட்டு மன்றம்) adalah sebuah dewan yang dipimpin pemerintah Singapura untuk mengarahkan organisasi akar rumput dan program masyarakat ke dalam unit-unit lokal yang lebih kecil sebagai jembatan antara pemerintah dan masyarakat. Dewan ini dica...

PT Perkebunan Nusantara XIGedung PTPN XI di SurabayaIndustriPerkebunanDidirikan14 Februari 1996KantorpusatSurabaya, IndonesiaTokohkunciTulus Panduwidjaja[1](Direktur Utama)Osmar Tanjung[2](Komisaris Utama)ProdukAlkoholSpiritusKarung plastikAMDKMerekElevenIndukPerkebunan Nusantara IIIAnakusahaPT PK Rosella Baru PT PASA Hilirisasi UsahaSitus webhttp://ptpn11.co.id/ PT Perkebunan Nusantara XI atau biasa disingkat menjadi PTPN XI, adalah sebuah perusahaan agribisnis yang fokus pad...

Каліакра Мис Каліакра Країна   Болгарія Регіон Варненська область Акваторії, що омивають Чорне море Координати 43°21′47″ пн. ш. 28°27′56″ сх. д. / 43.3633306° пн. ш. 28.465611° сх. д. / 43.3633306; 28.465611 Каліакра Координати: 43°21′47″ пн. ш. 28°27′56″ с�...

Logo Perhimpunan Pekabaran Injil Gereformeerd (GZB) Gereja dari kegiatan misionaris di tanah Toraja Perhimpunan Pekabaran Injil Gereformeerd atau dalam bahasa Belanda De Gereformeerde Zendingsbond (GZB) adalah missionaris yang berasal dari negeri Belanda. Berkantor pusat di Driebergen, Belanda. GZB ini memiliki sekitar 36.000 anggota (tahun 2011). Sejarah Asosiasi ini didirikan pada 1901 oleh pietistis direformasi dalam Gereja Reformasi Belanda. Kelompok Kristen tidak merasa terhubung dengan ...

Stadium in Cape Town, South Africa DHL Stadium (Cape Town Stadium)Full nameDHL StadiumLocationFritz Sonnenberg Road, Green Point, Cape Town, South AfricaCoordinates33°54′12.46″S 18°24′40.15″E / 33.9034611°S 18.4111528°E / -33.9034611; 18.4111528OwnerCity of Cape TownCapacity58,310Field size125m x 68m[1]SurfaceGrassConstructionBroke ground26 March 2007Built2007–2009Opened14 December 2009Construction costR 4.4 billion(USD $ 600 million£ 415 mi...

Data about an individual user For Wikipedia's guideline on its own user pages, see Wikipedia:User pages. User ProfilePersonal dataPurposeHighlight user information and characteristics A typical user profile A user profile is a collection of settings and information associated with a user. It contains critical information that is used to identify an individual, such as their name, age, portrait photograph and individual characteristics such as knowledge or expertise.[1] User profiles a...

Pocari SweatJenismerek AsalJepang Diperkenalkan1980 ProdusenOtsuka Pharmaceutical Situs webhttps://pocarisweat.jp/ [sunting di Wikidata]lbs Orang yang sedang meminum sebotol Pocari Sweat Pabrik Pocari Sweat di Sukabumi Pocari Sweat (ポカリスエットcode: ja is deprecated , Pokari Suetto) merupakan salah satu minuman ringan dan minuman olahraga terpopuler di Jepang, diproduksi oleh Otsuka Pharmaceutical Co, Ltd. Minuman ini pertama kali dijual pada tahun 1980 di Jepang dan sekara...

Religious demographics in the Philippines Religion in the Philippines 2020, Philippine Statistics Authority[1]   Roman Catholicism (78.8%)  Iglesia ni Cristo (2.6%)  Philippine Independent Church (1.4%)  Other Christians (1.9%)  Islam (6.4%)  Other / None (8.9%) Manila Cathedral in Intramuros, Manila This article is part of a series on theCulture of the Philippines Society History Language sign language People ethnic groups i...

Umar FathurrohmanKadisdikau Informasi pribadiLahir8 Oktober 1968 (umur 55)JakartaKebangsaanIndonesiaSuami/istriNy. Irni Hastuti Thaher, SE., MM.AnakMuhammad Habib SaggafLetda Pnb Muhammad Hadyan HadafiMuhammad Haikal MadaniMerindu Halimah BeautyAlma materAkademi Angkatan Udara (1990)Karier militerPihak IndonesiaDinas/cabang TNI Angkatan UdaraMasa dinas1990—sekarangPangkat Marsekal Pertama TNISatuanKorps Penerbang (Tempur)Sunting kotak info • L • B Marsekal Perta...

У Вікіпедії є статті про інших людей із прізвищем Грушецький. Іван Самійлович Грушецький Іван Самійлович Грушецький 1-й секретар Чернівецького обласного комітету КП (б) України серпень 1940 — серпень 1941 1-й секретар Львівського обласного комітету КП України 1944 —...

2023 Indian filmKickTheatrical release posterDirected byPrashant RajWritten byPrashant RajProduced byNaveen RajStarring Santhanam Tanya Hope CinematographySudhakar S. RajEdited byNagooran RamachandranMusic byArjun JanyaProductioncompanyFortune FilmsRelease date 1 September 2023 (2023-09-01) CountryIndiaLanguageTamil Kick is a 2023 Indian Tamil-language romantic comedy film written and directed by Prashant Raj. It is produced by Naveen Raj under the production banner Fortune Fil...

Indian actor and film producer In this Indian name, the name George is a patronymic, and the person should be referred to by the given name, Joju. This biography of a living person needs additional citations for verification. Please help by adding reliable sources. Contentious material about living persons that is unsourced or poorly sourced must be removed immediately from the article and its talk page, especially if potentially libelous.Find sources: Joju George – news ...

Japanese volleyball player Natsumi FujitaPersonal informationFull nameNatsumi FujitaNicknameNatsuBorn(1991-08-05)August 5, 1991Tagajo, Miyagi, JapanHeight1.66 m (5 ft 5 in)Weight50 kg (110 lb)Spike270 cm (106 in)Block261 cm (103 in)Volleyball informationPositionSetterCurrent clubToyota Auto Body QueenseisNumber4National team  Japan 2013- Natsumi Fujita (藤田 夏未 Fujita Natsumi, born August 5, 1991) is a Japanese volleyball player who...

Ignacy MościckiBerkas:1930sPresident of the Republic of Poland3rd President of the Second Polish RepublicMasa jabatan4 June 1926 – 30 September 1939Perdana MenteriKazimierz Bartel, Józef Piłsudski, Kazimierz Bartel, Kazimierz Świtalski, Kazimierz Bartel, Walery Sławek, Józef Piłsudski, Walery Sławek, Aleksander Prystor, Janusz Jędrzejewicz, Leon Kozłowski, Walery Sławek, Marian Zyndram-Kościałkowski, Felicjan Sławoj SkładkowskiPendahuluStanisław WojciechowskiPenggan...