Ла Бриса (Грал. Теран)
|
Read other articles:
Spur castle Not to be confused with Maglić. This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Maglič – news · newspapers · books · scholar · JSTOR (March 2010) (Learn how and when to remove this template message) MagličМаглич (Serbian)Kraljevo, Serbia Maglič FortressMagličМаглич (Ser...
Uganda vehicle license plates Uganda requires its residents to register their motor vehicles and display vehicle registration plates.[1] Uganda Government vehicles are written with red paint on a yellow/orange or white background. They all start with UG, followed by a number number finally a letter code to identify the ministry, department, or agency. Image First issued Design Slogan Serial format Serials issued Notes 1990 Police Government vehicles are identified with the following c...
State Route 124Map of Walla Walla County in southeastern Washington with SR 124 highlighted in redRoute informationAuxiliary route of US 12Maintained by WSDOTLength44.72 mi[1] (71.97 km)Existed1964–presentTouristroutes Lewis and Clark TrailMajor junctionsWest end US 12 in BurbankMajor intersections SR 125 near PrescottEast end US 12 in Waitsburg LocationCountryUnited StatesStateWashingtonCountiesWalla Walla Highway system State highw...
Universitas Nasional Cheng Kung 國立成功大學 Logo NCKU Motto:Mendalami untuk mengetahui Rektor Huey-Jen Su Status Nasional (Negeri) Berdiri 1931 Sekolah Tinggi Industri Tainan, 1971 resmi menjadi universitas Lokasi Tainan, Taiwan Jumlah mahasiswa S1 11.109; S2 9.183 (2018) Jumlah pengajar 1.400(2012) Luas kampus 186 hektare Universitas Nasional Cheng Kung (Hanzi: 國立成功大學; bahasa Inggris: National Cheng Kung University) adalah sebuah universitas negeri di Taiwan yang berloka...
Protests in Virginia caused by the murder of George Floyd George Floyd protests in VirginiaPart of George Floyd protestsDemonstration in Charlottesville, Virginia on May 30, 2020.DateMay 28 – August 16, 2020[1][2](2 months, 2 weeks and 5 days)LocationVirginia, United StatesCaused by Confederate monuments and memorials Police brutality Institutional racism against African Americans[3][4] Reaction to the murder of George Floyd Economic, racial an...
{{{Temporada da CART indycar World series de {{{ano}}}}}} Estatísticas Campeão Bobby Rahal Novato do Ano Stefan Johansson Vencedor da Indy 500 Al Unser, Jr. Fabricante do Chassi Campeão Lola Campeonato de Construtores Chevrolet Copa das Nações EUA Cronologia Anterior 1991 Atual 1992 Seguinte 1993 A Temporada da CART World Series de 1992 foi a décima-quarta da história da categoria. O campeão foi o norte-americano Bobby Rahal, da Rahal-Hogan Racing. Aos 39 anos, o piloto nascido em Med...
1815 siege during the Neapolitan War Siege of GaetaPart of the Neapolitan WarMap of the 1806 Siege of Gaeta showing the terrainDate28 May – 8 August 1815LocationGaeta, present-day Italy41°13′00″N 13°34′00″E / 41.2167°N 13.5667°E / 41.2167; 13.5667Result Coalition victory[1]Belligerents Austrian Empire United Kingdom Kingdom of Sicily Kingdom of NaplesCommanders and leaders Joseph Freiherr von Lauer Maresciallo di Campo Aless...
For other people named Ronald Cohen, see Ronald Cohen (disambiguation). The neutrality of this article is disputed. Relevant discussion may be found on the talk page. Please do not remove this message until conditions to do so are met. (November 2015) (Learn how and when to remove this template message) Sir Ronald CohenCohen in 2014BornRonald Mourad Cohen (1945-08-01) 1 August 1945 (age 78)EgyptNationalityBritishEducationOxford University Harvard Business SchoolOccupationVenture capitali...
2018 South African filmSTROOP - Journey into the Rhino Horn WarPromotional film posterDirected bySusan ScottProduced byBonné de BodSusan ScottCinematographySusan ScottEdited bySusan ScottRelease date September 2018 (2018-09) (San Francisco Green Film Festival) Running time134 minutesCountrySouth AfricaLanguageEnglish STROOP - Journey into the Rhino Horn War is a 2018 South African documentary film about rhino poaching made by first-time filmmakers Bonné de Bod, an SABC wildlif...
Islamic observation of prophet Muhammad's birthday This article is about Mawlid. For other uses, see Mawlid (disambiguation). MawlidMalaysian Sunni Muslims in a Mawlid procession in capital Putrajaya, 2013.Observed byAdherents of mainstream Sunni Islam, Shia Islam and various other Islamic denominationsTypeIslamicSignificanceCommemoration of the birth of MuhammadObservancesHamd, Tasbih, public processions, Na`at (religious poetry), family and other social gatherings, decoration of street...
Emperor of Russia from January to July 1762 This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Peter III of Russia – news · newspapers · books · scholar · JSTOR (October 2023) (Learn how and when to remove this template message) Peter IIIPortrait by Lucas Conrad Pfandzelt, c. 1761Emperor of RussiaReign5 January...
American politician This article uses bare URLs, which are uninformative and vulnerable to link rot. Please consider converting them to full citations to ensure the article remains verifiable and maintains a consistent citation style. Several templates and tools are available to assist in formatting, such as reFill (documentation) and Citation bot (documentation). (August 2022) (Learn how and when to remove this template message) Shane SchoellerSpeaker of the Missouri House of Representatives...
King Records King Records Co., Ltd キングレコード株式会社Nama asliキングレコードNama latinKinngu RekodoJenisKabushiki kaishaIndustriIndustri musik Industri hiburan Label RekamanGenrePop, J-Pop, Rock, enka, kayokyoku, AnisonDidirikanNovember 1951; 72 tahun lalu (1951-11) (Sebagai Perusahaan Label Rekaman) Januari 1931; 92 tahun lalu (1931-01) (Sebagai Divisi Penerbit dari Kodansha)KantorpusatBunkyo, Tokyo, JepangTokohkunciKiyoshi Murakami (村上潔) (Presiden dan C...
La Plaza Nueva de Cracovia (en polaco Plac Nowy) popularmente conocida como la Judía, por estar en el distrito de Kazimierz, es una plaza creada por las calles Estery, Izaaka, Nowa, Rabina Mieselsa y Waschauera. Vista general de la Plaza Nueva, con la rotonda en el centro La forma actual de la plaza se estableció en los proyectos de 1808 y 1844. La plaza consiste en un trapecio rectángulo, en cuyo centro encontramos el principal edificio, en forma de rotonda, y alrededor de este una serie ...
Indian dynasty (c. 225 – c.340) For other uses, see Ikshvaku (disambiguation). Ikshvakus of VijayapuriEarly 3rd century–early 4th centurySouth Asia350 CEYAUDHEYASARJUNAYANASMADRAKASMALAVASIKSHVAKUSKALABHRASWESTERNGANGASTOCHARIANSKADAMBASPALLAVASLITTLEKUSHANSLICCHAVISWESTERNSATRAPSSASANIANHINDMAHAMEGHA-VAHANASKAMARUPAGAUDASAMATATASDAVAKAKIDARITESABHIRASVAKATAKASGUPTAEMPIREKUSHANO-SASANIANSSAKASTANTURANMAKRANSASANIANEMPIRE ◁ ▷ Location of the Andhra Ikshvakus in c. 350 CECapitalVi...
Indonesian singer and actress Maudy AyundaMaudy Ayunda in 2019BornAyunda Faza Maudya (1994-12-19) December 19, 1994 (age 28)Jakarta, IndonesiaNationalityIndonesiaAlma materUniversity of Oxford (B.A.) Stanford University (M.B.A) (M.A.)Occupation(s)Singer, Songwriter, Celebrity, Activist, ModelYears active2005 - presentSpouse Jesse Choi (m. 2022)Musical careerGenresPopLabelsTrinity OptimaSuriaGPWebsitemaudyayunda.com Musical artist Ayunda Faza Maudy...
اضغط هنا للاطلاع على كيفية قراءة التصنيف جنس زهرة العسل زهرة العسل الكبيرة المرتبة التصنيفية جنس[1] التصنيف العلمي النطاق: حقيقيات النوى المملكة: نباتات الشعبة: حقيقيات الأوراق الشعيبة: بذريات الطائفة: ثنائيات الفلقة الطويئفة: وردانيات الرتبة العليا: ورداوايات الر�...
American smart home services provider Vivint Smart Home, Inc.TypeSubsidiaryTraded asNYSE: VVNT (2020–2023)IndustrySecurity systems, fire detection, home automationFounded1997; 26 years ago (1997) (as APX Alarm Security Solutions)FounderTodd PedersenKeith NellesenHeadquartersProvo, Utah, U.S.Key peopleRasesh Patel (president)RevenueUS$1,682 million (2022)Operating incomeUS$−154 million (2022)Net incomeUS$−51 million (2022)Total assetsUS$2,878 million...
Species of reptile This article includes a list of general references, but it lacks sufficient corresponding inline citations. Please help to improve this article by introducing more precise citations. (March 2015) (Learn how and when to remove this template message) Desert rosy boa Conservation status Least Concern (IUCN 3.1)[1] Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Chordata Class: Reptilia Order: Squamata Suborder: Serpentes Family: Boidae Genus:...
Serif typeface Typeface Times New RomanCategorySerifClassificationTransitionalOld-styleDesigner(s)Stanley MorisonVictor LardentCommissioned byThe TimesFoundryMonotypeDate released1932[1]LicenseProprietaryDesign based onPlantinMetrically compatible withTinos Times New Roman is a serif typeface. It was commissioned by the British newspaper The Times in 1931 and conceived by Stanley Morison, the artistic adviser to the British branch of the printing equipment company Monotype, in collabo...