Copán Ruinas is a municipality in the Honduran department of Copán. The town, located close to the Guatemalan border, is a major gateway for tourists traveling to the Pre-Columbian ruins of Copán. The Copán ruins house a UN World Heritage site and are renowned for the hieroglyphic staircase, stellae, and museum.
Every year in December, the town hosts the Conference on Honduras put on by Project Honduras. The conference is an opportunity for individuals and grassroots organizations to discuss ways to improve the quality of life in Honduras through addressing the social and economic needs of the country, primarily in the areas of education, healthcare, and community building. The theme of the Conference on Honduras on 18–20 October 2012 was "Understanding the Security Situation in Honduras".[2]
The town has many small language schools that offer classes for travelers.[citation needed]
The town is linked to the Honduran-Guatemalan border, approximately 20 minutes away by road to the Aduana El Florido station. Copán Ruinas Airport is a civilian-use facility about 20 km east of the town center. There is no public transport network, as most transit is done by small motorized taxi-bikes or tuk tuk. Private shuttles link Copán Ruinas to Guatemala City and Antigua Guatemala, and private company buses serve daily routes to San Pedro Sula and the Honduran capital Tegucigalpa.
This Honduras location article is a stub. You can help Wikipedia by expanding it.
Species of bird Broad-billed fairywren Conservation status Least Concern (IUCN 3.1)[1] Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Chordata Class: Aves Order: Passeriformes Family: Maluridae Genus: Chenorhamphus Species: C. grayi Binomial name Chenorhamphus grayi(Wallace, 1862) Synonyms Todopsis grayi Malurus grayi The broad-billed fairywren (Chenorhamphus grayi) is a species of bird in the Australasian wren family, Maluridae. It is found in northern a…
Fun guoSebuah baki kukus dengan tiga fun guoNama lainChaozhou fun guo, fun quor, fun gor, fen guo, dumpling Chiu Chow, dumpling Teochew, hung gue, fun korSajianYum chaTempat asalChaoshan, Guangdong, Tiongkok SelatanDibuat olehSuku Teochew Media: Fun guo Fun guo Hanzi tradisional: 潮州粉粿 Alih aksara Mandarin - Hanyu Pinyin: Cháozhōu fěnguǒ Min Nan - Romanisasi POJ: Tiô-chiu-hún-kué, Tiô-chiu-hún-ké Yue (Kantonis) - Jyutping: Ciu4 jau1 fan2 gwo2 Fun guo, atau Chaozhou fun…
American politician For those of a similar name, see James Edmonds (disambiguation). James M. EdmundsBorn(1810-08-23)August 23, 1810Niagara County, New YorkDiedDecember 14, 1879(1879-12-14) (aged 69)Washington, D.C. James M. Edmunds (August 23, 1810 – December 14, 1879) was a politician from the U.S. state of Michigan. Biography Edmunds was born in Niagara County, New York, received a common school and academic education and taught school from 1826 to 1831.[1] In 1831, he moved to…
Енрік Гальєго Особисті дані Народження 12 вересня 1986(1986-09-12) (37 років) Барселона, Іспанія Зріст 190 см Вага 87 кг Громадянство Іспанія Позиція нападник Інформація про клуб Поточний клуб «Осасуна» Юнацькі клуби 2003-2006 «Буен Пастор» «Граменет» «Бадалона» «Буен Пастор» П…
Thesentür an der Schlosskirche in der Lutherstadt Wittenberg Martin Luthers 95 Thesen – im lateinischen Original Disputatio pro declaratione virtutis indulgentiarum (Disputation zur Klärung der Kraft der Ablässe), in frühen deutschen Drucken Propositiones wider das Ablas –, in denen er sich gegen den Missbrauch des Ablasses und besonders gegen den geschäftsmäßigen Handel mit Ablassbriefen aussprach, wurden am 31. Oktober 1517 als Beifügung an einen Brief an den Erzbischof von Mainz u…
National flag For a list of all flags used by Norway or its subdivisions, see List of flags of Norway. Kingdom of NorwayUseNational flag and civil ensign Proportion8:11Adopted13 July 1821; 202 years ago (1821-07-13)DesignA red field charged with a white-fimbriated dark blue Nordic cross that extends to the edges; the vertical part of the cross is shifted to the hoist side.Designed byFredrik Meltzer UseState and war flag, state and naval ensign Proportion16:27 Kongeflagget …
Coleoxestia sanguinipes Klasifikasi ilmiah Kerajaan: Animalia Filum: Arthropoda Kelas: Insecta Ordo: Coleoptera Famili: Cerambycidae Genus: Coleoxestia Spesies: Coleoxestia sanguinipes Coleoxestia sanguinipes adalah spesies kumbang tanduk panjang yang tergolong famili Cerambycidae. Spesies ini juga merupakan bagian dari genus Coleoxestia, ordo Coleoptera, kelas Insecta, filum Arthropoda, dan kingdom Animalia. Larva kumbang ini biasanya mengebor ke dalam kayu dan dapat menyebabkan kerusakan pada …
2017 Tennessee Volunteers baseballConferenceSoutheastern ConferenceRecord27–25 (7–21 SEC)Head coachDave Serrano (6th season)Home stadiumLindsey Nelson StadiumSeasons← 20162018 → 2017 Southeastern Conference baseball standings vte Conf Overall Team W L T PCT W L T PCT Eastern No. 1 Florida x†y 21 – 9 – 0 .700 52 – 19 – 0 .732 No. 10 Kentucky …
هذه المقالة بحاجة لصندوق معلومات. فضلًا ساعد في تحسين هذه المقالة بإضافة صندوق معلومات مخصص إليها. هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (يونيو 2013) إدارة الثروة الحيوانية الوطنية للأبحاث الطبية الحيوية (NARF-BR…
بطرس الأكبر (بالروسية: Пётр I) معلومات شخصية اسم الولادة (بالروسية: Романов Пётр Алексеевич) الميلاد 9 يونيو 1672(1672-06-09)موسكو الوفاة 8 فبراير 1725 (52 سنة)سانت بطرسبرغ سبب الوفاة غنغرينا مكان الدفن كاتدرائية بطرس وبولس مواطنة روسيا القيصرية الإمبراطورية الروسية روس…
EmishiNama keluargaPengucapanEmishiWilayah asalJepangCatatan kaki: dari Namio, Egami, et al., Ainu to kodai Nippon. Japan: Shogakukan, 1982, hlm. 92. Emishi membayar upeti kepada Pangeran Shotoku. Diproduksi pada 1324, berdasarkan pada Shotokutaishi e-den e-maki, dibuat pada 1069. Emishi atau Ebisu (蝦夷code: ja is deprecated ) adalah kelompok etnis yang pernah menghuni kawasan Tōhoku di pulau Honshū timur laut. Daerah mereka disebut michi no oku (道の奥code: ja is deprecated ) dalam cata…
Australian singer (born 1997) For his eponymous album, see Cody Simpson discography. Cody SimpsonSimpson at the ARIA Music Awards of 2013Background informationBirth nameCody Robert Simpson[1]Born (1997-01-11) 11 January 1997 (age 26)Gold Coast, Queensland, AustraliaGenresPopR&B[2]Occupation(s)SingerswimmeractormodelbusinessmanInstrumentsVocalsguitarYears active2009–presentLabelsCoast HouseWebsitecodysimpson.comSports careerSportSwimmingStrokesButterflyClubGriffith Swim…
Protein-coding gene in the species Homo sapiens HOXC4IdentifiersAliasesHOXC4, HOX3, HOX3E, cp19, homeobox C4External IDsOMIM: 142974 MGI: 96195 HomoloGene: 8408 GeneCards: HOXC4 Gene location (Human)Chr.Chromosome 12 (human)[1]Band12q13.13Start54,016,931 bp[1]End54,056,030 bp[1]Gene location (Mouse)Chr.Chromosome 15 (mouse)[2]Band15 F3|15 58.08 cMStart102,927,366 bp[2]End102,945,278 bp[2]RNA expression patternBgeeHumanMouse (ortholog)Top expre…
Uralic language spoken in Russia Erzyaeŕźań keĺэрзянь кельNative toRussiaRegionMordovia, Nizhny Novgorod, Chuvashia, Ulyanovsk, Samara, Penza, Saratov, Orenburg, Tatarstan, BashkortostanEthnicity610,000 (553,000 in Russia, 2010 census)Native speakers300,000 claimed to speak Mordovin while 50,000 claimed to speak Erzya-Mordvin (2020 census)[1]Language familyUralic MordvinicErzyaWriting systemCyrillicOfficial statusOfficial language inMordovia (Russia)Language …
Кеті Венсанфр. Katie Vincent Загальна інформаціяНаціональність канадійкаГромадянство КанадаНародження 12 березня 1996(1996-03-12) (27 років)Міссіссога, Піл, Онтаріо, КанадаAlma mater Iona Catholic Secondary SchooldСпортКраїна КанадаВид спорту веслування на байдарках і каноеДисципліна веслування …
1886 Costa Rican general election ← 1882 4 April 1886 1889 → Presidential election Nominee Bernardo Soto Alfaro Electoral vote 547 Percentage 100% President before election Bernardo Soto Alfaro Elected President Bernardo Soto Alfaro General elections were held in Costa Rica on 4 April 1886.[1] After the death of Próspero Fernández Oreamuno in March 1885, Bernardo Soto Alfaro took over the presidency temporarily for the remainder of the term. Soto was a…
Pour les autres membres de la famille, voir Famille de Gondi. Jean-François de Gondi Anonyme, Jean-François de Gondi Biographie Naissance 1584Paris Décès 21 mars 1654 Paris Évêque de l'Église catholique Ordination épiscopale 19 février 1623, par le cardinal François d'Escoubleau de Sourdis Archevêque de Paris Henri de Gondi Jean-François Paul de Gondi (en) Notice sur www.catholic-hierarchy.org modifier Jean-François de Gondi né en 1584 à Paris et mort dans la même ville le …
Comic book series This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: The Superior Spider-Man – news · newspapers · books · scholar · JSTOR (April 2020) (Learn how and when to remove this template message) For the superseding title, see Superior Spider-Man Team-Up. The Superior Spider-ManCover of The Superior Spide…
هذه مقالة غير مراجعة. ينبغي أن يزال هذا القالب بعد أن يراجعها محرر مغاير للذي أنشأها؛ إذا لزم الأمر فيجب أن توسم المقالة بقوالب الصيانة المناسبة. يمكن أيضاً تقديم طلب لمراجعة المقالة في الصفحة المخصصة لذلك. (مايو 2020) هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا…
Historical dynasty based in Ghazni and Gardez Lawik dynastyc.750 CE–977 CE Ghazni was the power-center of the Lawik dynasty. Citadel of Ghazni pictured above LAWIKDYNASTYSAFFARIDSSAMANIDSABBASIDCALIPHATEBYZANTINEEMPIREGUJARA-PRATIHARAPALA EMPIREUTPALADYNASTYHINDUSHAHISclass=notpageimage| Approximate location of the Lawik dynastyHindu ShahisLAWIKSSamarkandHeratSAFFARIDS/SAMANIDS/GhaznavidsBalkhKandaharGhazniGardezKabulHundUTPALADYNASTYKHUDAHSBukharaAFSHINSBostclass=notpageimage| The Lawik Dynas…
Lokasi Pengunjung: 3.137.215.61