Бета-ланцюг фібриногену

Бета-ланцюг фібриногену
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи FGB, HEL-S-78p, fibrinogen beta chain
Зовнішні ІД OMIM: 134830 MGI: 99501 HomoloGene: 3772 GeneCards: FGB
Пов'язані генетичні захворювання
Factor I Deficiency, congenital afibrinogenemia[1]
Реагує на сполуку
фібринолізин[2]
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001184741
NM_005141
NM_181849
RefSeq (білок)
NP_862897
Локус (UCSC) Хр. 4: 154.56 – 154.57 Mb Хр. 3: 82.95 – 82.96 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Бета-ланцюг фібриногену (англ. Fibrinogen beta chain) – білок, який кодується геном FGB, розташованим у людей на короткому плечі 4-ї хромосоми. [5] Довжина поліпептидного ланцюга білка становить 491 амінокислот, а молекулярна маса — 55 928[6].

Послідовність амінокислот
1020304050
MKRMVSWSFHKLKTMKHLLLLLLCVFLVKSQGVNDNEEGFFSARGHRPLD
KKREEAPSLRPAPPPISGGGYRARPAKAAATQKKVERKAPDAGGCLHADP
DLGVLCPTGCQLQEALLQQERPIRNSVDELNNNVEAVSQTSSSSFQYMYL
LKDLWQKRQKQVKDNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVLRS
ILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGE
TSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYK
QGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGD
KVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIH
NGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGG
QYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFPQQ

Задіяний у таких біологічних процесах як адаптивний імунітет, зсідання крові, гемостаз, імунітет, вроджений імунітет. Секретований назовні.

Література

  • Chung D.W., Que B.G., Rixon M.W., Mace M. Jr., Davie E.W. (1983). Characterization of complementary deoxyribonucleic acid and genomic deoxyribonucleic acid for the beta chain of human fibrinogen. Biochemistry. 22: 3244—3250. PMID 6688356 DOI:10.1021/bi00282a032
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Chung D.W., Rixon M.W., Que B.G., Davie E.W. (1983). Cloning of fibrinogen genes and their cDNA. Ann. N. Y. Acad. Sci. 408: 449—456. PMID 6575700 DOI:10.1111/j.1749-6632.1983.tb23265.x
  • Watt K.W.K., Takagi T., Doolittle R.F. (1979). Amino acid sequence of the beta chain of human fibrinogen. Biochemistry. 18: 68—76. PMID 420779 DOI:10.1021/bi00568a011
  • Blombaeck B., Hessel B., Hogg D. (1976). Disulfide bridges in NH2-terminal part of human fibrinogen. Thromb. Res. 8: 639—658. PMID 936108 DOI:10.1016/0049-3848(76)90245-0
  • Henschen A., Lottspeich F., Kehl M., Southan C. (1983). Covalent structure of fibrinogen. Ann. N. Y. Acad. Sci. 408: 28—43. PMID 6575689 DOI:10.1111/j.1749-6632.1983.tb23232.x

Примітки

Див. також

Read other articles:

Koordinat: 51°30′32″N 0°08′51″W / 51.508755°N 0.14743°W / 51.508755; -0.14743 Mayfair Royal Arcade di Old Bond Street Mayfair Letak Mayfair di London Raya Ref. grid OS TQ285805 Borough London Westminster County seremonial Greater London Wilayah London Negara konstituen Inggris Negara berdaulat Britania Raya Kota pos LONDON Distrik kode pos W1K, W1J Kode telepon 020 Polisi Metropolitan Pemadam kebakaran London Amb...

 

См. также: Лира (валюта) Итальянская лира итал. Lira italiana англ. Italian Lira[a] фр. Lire italienne[a] Банкнота 2000 лир Коды и символы Коды ISO 4217 ITL (380) Символы £ (₤) • L Территория обращения Страна-эмитент  Италия Официально  Ватикан Сан-Марино Производные и параллель�...

 

Halaman ini berisi artikel tentang karya buatan Rabbi Yosef Karo. Untuk karya buatan Rabbi Schneur Zalman dari Liadi, lihat Shulchan Aruch HaRav. Untuk karya buatan rabbi dan posek Lithuania Yechiel Michel Epstein, lihat Aruch HaShulchan. Shulchan Aruch PengarangJoseph KaroNegaraTanah IsraelBahasaIbraniSubjekHukum YudaisTanggal terbit1565, Venesia Shulchan Aruch (Ibrani: שֻׁלְחָן עָרוּך [ʃulˈħan ʕaˈʁuχ]),[1] terkadang disebut sebagai Kode Hukum Yahudi, adalah...

Koin Andriskos dengan tulisan ΒΑΣΙΛΕΩΣ ΦΙΛΙΠΠΟΥ (Raja Filipos). Andriskos (bahasa Yunani Kuno: Ἀνδρίσκος) adalah raja terakhir Makedonia yang berkuasa dari tahun 149-148 SM dengan nama Raja Filipos. Ia mengklaim sebagai anak dari Raja Perseus dari Makedonia yang sebelumnya dijatuhkan oleh Republik Romawi pada tahun 168 SM. Andriskos mencoba membebaskan Makedonia dari Romawi dan mengakibatkan Perang Makedonia Keempat, tetapi pada akhirnya upayanya dipatahkan oleh ...

 

Cet article est une ébauche concernant l’islam. Vous pouvez partager vos connaissances en l’améliorant (comment ?) selon les recommandations des projets correspondants. Hachim ibn Abd ManafBiographieNaissance La MecqueDécès Vers 497GazaNom dans la langue maternelle هاشم بن عبد منافActivité MarchandPère Abd Manaf ibn Qusay (en)Mère Atika bint Mourra (en)Fratrie Abd Shams ibn Abd ManafAbd al Amr (d)Muttalib ibn Abd Manaf (en)Muttalib ibn Abd Manaf (en) (frère...

 

1953 Dutch Grand Prix ← Previous raceNext race → Zandvoort original layoutRace detailsDate 7 June 1953Official name IV Grote Prijs van NederlandLocation Circuit Park Zandvoort, Zandvoort, NetherlandsCourse Permanent racing facilityCourse length 4.193 km (2.605 miles)Distance 90 laps, 377.370 km (234.488 miles)Weather Sunny, mild, dryPole positionDriver Alberto Ascari FerrariTime 1:51.1Fastest lapDriver Luigi Villoresi FerrariTime 1:52.8 on lap 59PodiumFirst Alberto Asc...

Defunct American television production company Not to be confused with Four Star Records. Four Star TelevisionFormerlyFour Star Productions (1952-1959)Company typeSubsidiaryIndustryTelevision productionFounded1952 (as Four Star Productions)Incorporated as Four Star Television on Jan. 12, 1959.FoundersDick PowellDavid NivenCharles BoyerIda LupinoJoel McCreaDefunct1997, after purchase to New World TelevisionFateSold to Compact Video as the result of a Leveraged buyout by MacAndrews & Forbes...

 

ÉlectricienPrésentationForme féminine ÉlectricienneSecteur Installation électriqueMétiers voisins ÉlectrotechnicienCompétencesDiplômes requis CAP Électricien Bac pro Métiers de l'électricité et de ses environnements connectésFonctionRisques électrisation, électrocutionCodesCITP 7411ROME (France) F1602modifier - modifier le code - modifier Wikidata Électricien est le nom donné au métier qu'exercent les personnes dans le domaine de l'électricité. Il est issu du terme élect...

 

Head of state of the Republic of Slovenia President of the Republic of SloveniaPredsednik Republike SlovenijeFlag of the PresidentIncumbentNataša Pirc Musarsince 23 December 2022Office of the President of the RepublicStyleMadam President(Slovene: Gospa predsednica) (informal)Her Excellency(Slovene: Njena ekscelenca) (diplomatic)TypeHead of stateMember ofNational Security Council (upon invitation of the Prime Minister)Reports toNational AssemblyResidenceNoneSeatGregorčičeva 251000 Ljub...

Військово-музичне управління Збройних сил України Тип військове формуванняЗасновано 1992Країна  Україна Емблема управління Військово-музичне управління Збройних сил України — структурний підрозділ Генерального штабу Збройних сил України призначений для планува...

 

Cet article est une ébauche concernant un musée, le catholicisme et Montréal. Vous pouvez partager vos connaissances en l’améliorant (comment ?) selon les recommandations des projets correspondants. Ne doit pas être confondu avec Musée canadien de l'histoire. Musée historique canadienLes jumelles Hélène et Jacqueline Saint-Jean regardent une représentation d'une scène de la Bible, le 23 septembre 1946Informations généralesType Musée de cire, musée historique (d), musée...

 

Bridge in Schiers, SwitzerlandSalginatobel BridgeSoutheast view, from an angleCoordinates46°58′54.55″N 9°43′3.81″E / 46.9818194°N 9.7177250°E / 46.9818194; 9.7177250CrossesSalgina Ravine[1]LocaleSchiers, Switzerland[1]CharacteristicsDesignthree-hinged reinforced concrete hollow box girder arch bridge[1]MaterialReinforced concreteTotal length133 metres (436 ft)Width3.5 metres (11 ft)Height90 metres (300 ft)Longest span9...

2022 Argentine television series Secrets of SummerSpanishCielo grande GenreMusicalRomanceMysteryCreated byJorge EdelsteinWritten by Jorge Edelstein Celeste Lambert Paula Velayos Clara Charrúa Directed by Mauro Scandolari Starring Pilar Pascual Abril Di Yorio Víctor Varona Guido Messina Francisco Bass Giulia Guerrini Thaís Rippel Luan Brum Fernando Monzo Juan Monzo Agustín Pardella Mariel Percossi Byron Barbieri Martín Tecchi Débora Nishimoto Country of originArgentinaOriginal languageSp...

 

Геркулесовы столбы Государство  Марокко Испания Гибралтар Местонахождение Гибралтарский пролив Геркулесовы столбы  Медиафайлы на Викискладе Геркулесовы столбы — Гибралтарская скала (на переднем плане) и горы Северной Африки (на заднем) Геркуле́совы сто�...

 

British politician (1762–1834) This article is written like a personal reflection, personal essay, or argumentative essay that states a Wikipedia editor's personal feelings or presents an original argument about a topic. Please help improve it by rewriting it in an encyclopedic style. (July 2021) (Learn how and when to remove this message) The Right HonourableThe Earl BathurstKG PCPortrait of Henry Bathurst, 3rd Earl Bathurst by William SalterPresident of the Board of TradeIn office31 March...

Besi panas memindahkan panas ke lingkungannya melalui radiasi termal Perpindahan panas adalah perpindahan energi akibat adanya perbedaan suhu di antara dua tempat yang berbeda. Bahasan utama dalam perpindahan panas ialah cara energi di dalam panas dapat berpindah tempat dan laju perpindahannya dalam kondisi tertentu.[1] Perpindahan panas meliputi proses pemasukan dan pengeluaran panas. Dalam proses industri, perpindahan panas digunakan untuk mencapai suhu yang diperlukan dalam proses ...

 

Suite of rooms in the Apostolic Palace in Vatican City Borgia Apartmentsclass=notpageimage| Location on a map of Vatican City The Borgia Apartments are a suite of rooms in the Apostolic Palace in the Vatican, adapted for personal use by Pope Alexander VI (Rodrigo de Borja). In the late 15th century, he commissioned the Italian painter Bernardino di Betto (Pinturicchio) and his studio to decorate them with frescoes.[1] The paintings and frescoes, which were executed between 1492 and 14...

 

Piazza Gae AulentiLocalizzazioneStato Italia CittàMilano CircoscrizioneMunicipio 9 Quartiere Isola Informazioni generaliTipoPedonale IntitolazioneGae Aulenti Costruzione2012 CollegamentiTrasporti Garibaldi FS Stazione di Milano Porta Garibaldi Stazione di Milano Porta Garibaldi sotterranea MappaPiazza Gae Aulenti Modifica dati su Wikidata · Manuale Piazza Gae Aulenti è una piazza pedonale della città di Milano. Sopraelevata e di forma circolare, ha un diametro di 100 metri ed è...

Questa voce sull'argomento calciatori cileni è solo un abbozzo. Contribuisci a migliorarla secondo le convenzioni di Wikipedia. Segui i suggerimenti del progetto di riferimento. Juan DelgadoNazionalità Cile Altezza177 cm Calcio RuoloCentrocampista Squadra Sheffield Weds CarrieraSquadre di club1 2011-2014 Colo-Colo B34 (9)2011-2016 Colo-Colo76 (14)2016-2018 Gimnàstic41 (5)2018-2019→  Tondela44 (7)2019-2021 Necaxa58 (7)2021-2023 Paços Ferreira...

 

1972 US comedy-drama film by Milton Katselas This article is about the film. For the play, see Butterflies Are Free (play). Butterflies Are FreePosterDirected byMilton KatselasWritten byLeonard GersheProduced byM. J. FrankovichStarringGoldie HawnEileen HeckartEdward AlbertCinematographyCharles B. LangEdited byDavid BlewittMusic byBob AlcivarProductioncompanyFrankovich ProductionsDistributed byColumbia PicturesRelease date July 6, 1972 (1972-07-06) Running time109 minutesCountry...