SLC20A1

SLC20A1
Ідентифікатори
Символи SLC20A1, GLVR1, Glvr-1, PIT1, PiT-1, solute carrier family 20 member 1
Зовнішні ІД OMIM: 137570 MGI: 108392 HomoloGene: 38049 GeneCards: SLC20A1
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005415
NM_001159593
NM_015747
NM_001355252
RefSeq (білок)
NP_005406
NP_001153065
NP_056562
NP_001342181
Локус (UCSC) Хр. 2: 112.65 – 112.66 Mb Хр. 2: 129.04 – 129.05 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SLC20A1 (англ. Solute carrier family 20 member 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 679 амінокислот, а молекулярна маса — 73 700[4].

Послідовність амінокислот
1020304050
MATLITSTTAATAASGPLVDYLWMLILGFIIAFVLAFSVGANDVANSFGT
AVGSGVVTLKQACILASIFETVGSVLLGAKVSETIRKGLIDVEMYNSTQG
LLMAGSVSAMFGSAVWQLVASFLKLPISGTHCIVGATIGFSLVAKGQEGV
KWSELIKIVMSWFVSPLLSGIMSGILFFLVRAFILHKADPVPNGLRALPV
FYACTVGINLFSIMYTGAPLLGFDKLPLWGTILISVGCAVFCALIVWFFV
CPRMKRKIEREIKCSPSESPLMEKKNSLKEDHEETKLSVGDIENKHPVSE
VGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDLKEETSIDSTVNG
AVQLPNGNLVQFSQAVSNQINSSGHYQYHTVHKDSGLYKELLHKLHLAKV
GDCMGDSGDKPLRRNNSYTSYTMAICGMPLDSFRAKEGEQKGEEMEKLTW
PNADSKKRIRMDSYTSYCNAVSDLHSASEIDMSVKAEMGLGDRKGSNGSL
EEWYDQDKPEVSLLFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYD
TGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDLTPITPSSGF
SIELASALTVVIASNIGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNI
FMAWFVTVPISGVISAAIMAIFRYVILRM

Кодований геном білок за функціями належить до рецепторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транспорт, симпортний транспорт. Локалізований у мембрані.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Palmer G., Manen D., Bonjour J.-P., Caverzasio J. (1999). Characterization of the human Glvr-1 phosphate transporter/retrovirus receptor gene and promoter region. Gene. 226: 25—33. PMID 9889306 DOI:10.1016/S0378-1119(98)00572-1
  • Farrell K.B., Russ J.L., Murthy R.K., Eiden M.V. (2002). Reassessing the role of region A in Pit1-mediated viral entry. J. Virol. 76: 7683—7693. PMID 12097582 DOI:10.1128/JVI.76.15.7683-7693.2002
  • Cecil D.L., Rose D.M., Terkeltaub R., Liu-Bryan R. (2005). Role of interleukin-8 in PiT-1 expression and CXCR1-mediated inorganic phosphate uptake in chondrocytes. Arthritis Rheum. 52: 144—154. PMID 15641067 DOI:10.1002/art.20748
  • Johann S.V., Gibbons J.J., O'Hara B. (1992). GLVR1, a receptor for gibbon ape leukemia virus, is homologous to a phosphate permease of Neurospora crassa and is expressed at high levels in the brain and thymus. J. Virol. 66: 1635—1640. PMID 1531369
  • Johann S.V., van Zeijl M., Cekleniak J., O'Hara B. (1993). Definition of a domain of GLVR1 which is necessary for infection by gibbon ape leukemia virus and which is highly polymorphic between species. J. Virol. 67: 6733—6736. PMID 8411375

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:10946 (англ.) . Архів оригіналу за 10 вересня 2015. Процитовано 28 серпня 2017.
  4. UniProt, Q8WUM9 (англ.) . Архів оригіналу за 31 липня 2017. Процитовано 28 серпня 2017.

Див. також

Read other articles:

Медаль Військової Заслуги («Signum Laudis») Країна Австро-УгорщинаТип МедальВручається: офіцерам і військовим чиновникам відповідного рангуПідстава за визнання видатних досягнень під час війни чи бездоганної служби у мирний час на користь Австро-Угорської монархіїСтатус в�...

Untuk kota di Selandia Baru, lihat Palmerston North. Palmy (ปาล์มมี่)Informasi latar belakangNama lahirEve Pancharoen (อีฟ ปานเจริญ)Lahir7 Agustus 1981 (umur 42)Bangkok, ThailandGenrePop rockPekerjaanPenyanyiInstrumenVokalTahun aktif2001–sekarangLabelIndependen Eve Pancharoen (bahasa Thai: อีฟ ปานเจริญ - lahir 7 Agustus 1981), yang lebih dikenal dengan nama panggungnya Palmy (bahasa Thai: ปาล์มมี่), ada...

Ismail Omar GuellehPresiden Jibuti ke-2PetahanaMulai menjabat 8 Mei 1999PendahuluHassan Gouled Aptidon Informasi pribadiLahir27 November 1947 (umur 76)Dire Dawa, EthiopiaPartai politikPeople's Rally for ProgressSuami/istriKadra Mahmoud HaidSunting kotak info • L • B Ismaïl Omar Guelleh (Somalia: Ismaaciil Cumar Geelle. Arab: اسماعيل عُمر جليه; lahir 27 November 1947)[1]) tampil kedua sebagai Presiden Jibuti saat ini. Ia menggantikan pamannya, Has...

Dieser Artikel beschreibt die Geschichte des Hörfunks allgemein. Die spezielle deutsche Sicht findet sich in Geschichte des Hörfunks in Deutschland. Sendemast in Brant Rock (Postkarte, um 1910) Die Hörfunkgeschichte umfasst die Entwicklung des Hörfunks und der dazugehörenden Geräte wie Antennen und Radioempfängern. Sie beginnt Anfang des 20. Jahrhunderts und ist eng verbunden mit der Geschichte des Telefons und der drahtlosen Telegrafie sowie Fortschritten in der Physik auf d...

1951 film Mamma Mia, What an Impression!Directed byRoberto SavareseWritten byAlberto Sordi Cesare ZavattiniProduced byAlberto Sordi Vittorio De SicaStarringAlberto Sordi Giovanna Pala Carlo GiustiniCinematographyCarlo MontuoriEdited byEraldo Da RomaMusic byAngelo Francesco LavagninoProductioncompanyProduzione Films ComiciDistributed byENICRelease date21 March 1951Running time98 minutesCountryItalyLanguageItalian Sordi and Pala Pala, Giustini and Sordi Mamma Mia, What an Impression! (Italian: ...

تومي توبرفيل (بالإنجليزية: Tommy Tuberville)‏    مناصب عضو مجلس الشيوخ الأمريكي[1]   عضو خلال الفترة3 يناير 2021  – 3 يناير 2023  انتخب في انتخابات مجلس الشيوخ الأمريكي في ألاباما 2020  [لغات أخرى]‏  فترة برلمانية الكونغرس الأمريكي السابع عشر بعد المائة  دوغ جو�...

Historical region in Ukraine Dnieper Ukraine, 17th–18th centuries The term Dnieper Ukraine[1] (Ukrainian: Наддніпрянщина, romanized: Naddniprianshchyna: over Dnieper land), usually refers to territory on either side of the middle course of the Dnieper River. The Ukrainian name derives from nad‑ (prefix: above, over) + Dnipró (Dnieper) + ‑shchyna (suffix denoting a geographic region). Historically, this region is tightly entwined with the history of Ukraine an...

2015 single by ASAP Rocky For other songs with the same name, see LSD (disambiguation) § Songs. LSDSingle by A$AP Rockyfrom the album At.Long.Last.ASAP ReleasedMay 21, 2015Recorded2014Genre Neo-soul Alternative R&B neo-psychedelia Length3:58Label Polo Grounds RCA Songwriter(s) Rakim Mayers Issac de Boni Michael Burman Hector Delgado Bobbie Gentry Michael Mule James Scheffer Producer(s) Hector Delgado Jim Jonsin Finatik N Zac ASAP Rocky singles chronology Everyday (2015) LSD (201...

From Vegas to Macau IIIPoster film resmiNama lainTradisional賭城風雲IIISederhana赌城风云IIIMandarinDǔ Chéng Fēng Yún SānKantonDou2 Sing4 Fung1 Wan4 Saam1 Sutradara Wong Jing Andrew Lau Produser Wong Jing Andrew Lau Connie Wong Ditulis oleh Wong Jing SkenarioWong JingPemeranChow Yun-fatAndy LauNick CheungLi YuchunJacky CheungCarina LauPenata musikChan Kwong-wingChan Chi-yatSinematograferAndrew LauCho Man-keungPenyuntingAzrael ChungPerusahaanproduksiMega-Vision Project ...

American academic Julia Evangeline BrooksBornJune 1882[1]New Orleans, Louisiana, US[2]DiedNovember 24, 1948[2]Washington, D.C., US[2]Occupation(s)incorporator of Alpha Kappa Alpha Sorority, Incorporated; Assistant principal and dean of girls at Dunbar High School in Washington, D.C.[2]Parent(s)Walter Henderson Brooks and Eva Holmes Brooks[2] Julia Evangeline Brooks (June, 1882 – November 24, 1948) was an incorporator of Alpha Kappa Alpha S...

Bandar Udara Internasional Bucharest Henri CoandǎAeroportul Internaţional Henri CoandăOtopeni AirportIATA: OTPICAO: LROPInformasiJenisPublik/MiliterPengelolaThe National Company Bucharest Airports S.A.MelayaniBucharest LokasiOtopeni, RomaniaMaskapai penghubung Air Bucharest Blue Air TAROM Ţiriac Air Wizz Air Ketinggian dpl96 mdplSitus webwww.otp-airport.roPetaOTPLokasi di RomaniaLandasan pacu Arah Panjang Permukaan m kaki 08R/26L 3,500 11,484 Aspal 08L/26R 3,500 11,484 Aspal Hel...

Halaman ini berisi artikel tentang kabupaten di Kalimantan Selatan. Untuk kegunaan lain, lihat Kota Banjar. Kabupaten BanjarKabupatenTranskripsi bahasa daerah • JawiبنجرTaman Hutan Raya Sultan Adam LambangJulukan: Melayu MartapuraMotto: Barakat(Banjar) BerkahPetaKabupaten BanjarPetaKoordinat: 3°24′29″S 114°50′55″E / 3.40813134°S 114.84854166°E / -3.40813134; 114.84854166Negara IndonesiaProvinsiKalimantan SelatanTanggal be...

This article is about the 1995 crime novel. For the 2005 historical novel, see Dilly Court. First edition (publ. HarperCollins) The Mermaids Singing (1995) is a crime novel by Scottish author Val McDermid.[1] The first featuring her recurring protagonist, Dr. Tony Hill,[2] it was adapted into the pilot episode of ITV1's television series based on McDermid's work, Wire in the Blood, starring Robson Green and Hermione Norris. The title is part of the fifth line from the poem Son...

1979 American filmThe French Atlantic AffairFirst edition (publ. Atheneum Books)Directed byDouglas HeyesWritten byDouglas HeyesBased onThe French Atlantic Affair by Ernest LehmanStarringTelly SavalasChad EverettMichelle PhillipsShelley WintersHorst BuchholzCinematographyRalph WoolseyEdited byTom StevensJamie CaylorMusic byJohn AddisonProductioncompaniesAaron Spelling ProductionsMGM TelevisionRelease dateNovember 15-18, 1979Running time278 minutesCountryUnited StatesLanguageEnglish The French ...

1893 advertisements in Farm Journal for horse tread powers and sweep powers, and for various mills that horses can power (feed/fodder cutters and grain grinders)This article may require cleanup to meet Wikipedia's quality standards. The specific problem is: Large and heavy header, text-focused images, and lengthy main section. Please help improve this article if you can. (March 2023) (Learn how and when to remove this template message) A horse engine (also called a horse power or horse-power)...

Phagocytic white blood cells containing an iron storage compound Histopathology of a case of chronic pulmonary congestion, showing a siderophage (white arrow, characterized by coarse brown pigment, which is slightly refractile), and interstitium with edema, hemosiderin deposition (black arrow) and collagenous thickening. Siderophages (brown spots) in an endometriotic focus. A siderophage is a hemosiderin-containing macrophage. Heart failure cells are siderophages generated in the alveoli of t...

Активна зона дослідного реактора. Добре видно блакитне світло — випромінювання Вавилова — Черенкова. Я́дерний реа́ктор — пристрій, призначений для організації керованої самопідтримуваної ланцюгової реакції поділу, яка завжди супроводжується виділенням енер...

US Army Medal of Honor recipient from the Apache Wars (fl. 1872–1875) ElsatsoosuElsatsoosu c. 1873BornArizona Territory, United StatesDiedunknownAllegianceUnited States of AmericaService/branchUnited States ArmyYears of servicec. 1872–1875RankCorporalUnitU.S. Army Indian ScoutsBattles/warsIndian WarsApache WarsAwardsMedal of Honor Elsatsoosu (fl. 1872–1875), also called Elsatsoosh, was an Apache Indian scout in the U.S. Army who served under Lieutenant Colonel George Crook during t...

Slovak footballer and coach (1932–2020) This biography of a living person needs additional citations for verification. Please help by adding reliable sources. Contentious material about living persons that is unsourced or poorly sourced must be removed immediately from the article and its talk page, especially if potentially libelous.Find sources: Ján Hucko – news · newspapers · books · scholar · JSTOR (November 2008) (Learn how and when to remove t...

Reference model in computer science The RM-ODP view model, which provides five generic and complementary viewpoints on the system and its environment. Reference Model of Open Distributed Processing (RM-ODP) is a reference model in computer science, which provides a co-ordinating framework for the standardization of open distributed processing (ODP). It supports distribution, interworking, platform and technology independence, and portability, together with an enterprise architecture framework...