C-реактивний білок

CRP
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CRP, PTX1, C-reactive protein, pentraxin-related, C-Reactive Protein
Зовнішні ІД OMIM: 123260 MGI: 88512 HomoloGene: 128039 GeneCards: CRP
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000567
NM_001329057
NM_001329058
NM_001382703
NM_007768
RefSeq (білок)
NP_000558
NP_001315986
NP_001315987
NP_001369632
NP_031794
Локус (UCSC) Хр. 1: 159.71 – 159.71 Mb Хр. 1: 172.53 – 172.66 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

C-реактивний білок (англ. C-reactive protein) – білок, який кодується геном CRP, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 224 амінокислот, а молекулярна маса — 25 039[4].

Послідовність амінокислот
1020304050
MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA
FTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEI
LFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRVRKSLKKGYTVGAEAS
IILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSP
NVLNWRALKYEVQGEVFTKPQLWP

Задіяний у такому біологічному процесі як гостра фаза запалення. Білок має сайт для зв'язування з іонами металів, іоном кальцію. Секретований назовні.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Whitehead A.S., Bruns G.A.P., Markham A.F., Colten H.R., Woods D.E. (1983). Isolation of human C-reactive protein complementary DNA and localization of the gene to chromosome 1. Science. 221: 69—71. PMID 6857266 DOI:10.1126/science.6857266
  • Osmand A.P., Gewurz H., Friedenson B. (1977). Partial amino-acid sequences of human and rabbit C-reactive proteins: homology with immunoglobulins and histocompatibility antigens. Proc. Natl. Acad. Sci. U.S.A. 74: 1214—1218. PMID 403526 DOI:10.1073/pnas.74.3.1214
  • Thompson D., Pepys M.B., Wood S.P. (1999). The physiological structure of human C-reactive protein and its complex with phosphocholine. Structure. 7: 169—177. PMID 10368284 DOI:10.1016/S0969-2126(99)80023-9
  • Woo P., Korenberg J.R., Whitehead A.S. (1985). Characterization of genomic and complementary DNA sequence of human C-reactive protein, and comparison with the complementary DNA sequence of serum amyloid P component. J. Biol. Chem. 260: 13384—13388. PMID 3840479
  • Oliveira E.B., Gotschlich E.C., Liu T.-Y. (1979). Primary structure of human C-reactive protein. J. Biol. Chem. 254: 489—502. PMID 762075

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:2367 (англ.) . Архів оригіналу за 23 грудня 2017. Процитовано 25 серпня 2017. [Архівовано 2017-12-23 у Wayback Machine.]
  4. UniProt, P02741 (англ.) . Архів оригіналу за 27 серпня 2017. Процитовано 25 серпня 2017.

Див. також

Read other articles:

Pakistani film distribution company Geo FilmsLogo used as of 2015IndustryFilm distributionFounded2007HeadquartersKarachi, PakistanOwnerImran Aslam (CEO) Rehmat Fazli (director)ParentGeo Television NetworkWebsitegeofilms.tv Geo Films is a film production and distribution company owned by Geo Television Network based in Karachi, Pakistan.[1] Geo Films distributes Hollywood, Lollywood and Indian films in cinemas across Pakistan.[2] Films distributed Foreign films The following is...

 

French soldier Claude de Roux, chevalier de Saint-LaurentGovernor of Saint ChristopheIn officeApril 1666 – February 1689Preceded byCharles de SalesSucceeded byCharles de Pechpeyrou-Comminges de GuitautGovernor general of the French Antilles (acting)In officeMarch 1683 – June 1684Preceded byCharles de Courbon de BlénacSucceeded byCharles de Courbon de BlénacGovernor of Martinique (interim)In officeFebruary 1689 – 31 March 1689Preceded byCharles de Pechpeyrou-...

 

Leverkusen Lambang kebesaranLetak Leverkusen NegaraJermanNegara bagianNordrhein-WestfalenWilayahKölnKreisdistrik kotaPemerintahan • MayorErnst Küchler (SPD) • Governing partiesCDU / SPD / BürgerlisteLuas • Total78,85 km2 (3,044 sq mi)Ketinggian60 m (200 ft)Populasi (2008-06-30) • Total161.279 • Kepadatan20/km2 (53/sq mi)Zona waktuWET/WMPET (UTC+1/+2)Kode area telepon0214, 02171 & 02173Pelat k...

Artikel ini perlu dikembangkan dari artikel terkait di Wikipedia bahasa Inggris. (Agustus 2023) klik [tampil] untuk melihat petunjuk sebelum menerjemahkan. Lihat versi terjemahan mesin dari artikel bahasa Inggris. Terjemahan mesin Google adalah titik awal yang berguna untuk terjemahan, tapi penerjemah harus merevisi kesalahan yang diperlukan dan meyakinkan bahwa hasil terjemahan tersebut akurat, bukan hanya salin-tempel teks hasil terjemahan mesin ke dalam Wikipedia bahasa Indonesia. Jan...

 

Artikel ini tidak memiliki referensi atau sumber tepercaya sehingga isinya tidak bisa dipastikan. Tolong bantu perbaiki artikel ini dengan menambahkan referensi yang layak. Tulisan tanpa sumber dapat dipertanyakan dan dihapus sewaktu-waktu.Cari sumber: Golding Bird – berita · surat kabar · buku · cendekiawan · JSTOR Golding Bird (1814–1854) adalah seorang dokter medis berkebangsaan Inggris dan seorang mahasiswa di Royal College of Physicians of Londo...

 

Dalam artikel ini, nama keluarganya adalah Padjalangi, nama keluarga patronimik Bugis; Andi adalah gelar kehormatan bangsawan Bugis. Andi Fahsar M. Padjalangi Bupati Bone ke-13Masa jabatan26 September 2018 – 26 September 2023PresidenJoko WidodoGubernurNurdin Abdullah Andi Sudirman Sulaiman Bahtiar Baharuddin (Pj.)WakilAmbo DallePendahuluAndi Bakti Haruni (Pj.)PenggantiAndi Islamuddin (Pj.)Masa jabatan18 April 2013 – 18 April 2018PresidenSusilo Bambang Yudhoyono Joko ...

Artikel ini membutuhkan rujukan tambahan agar kualitasnya dapat dipastikan. Mohon bantu kami mengembangkan artikel ini dengan cara menambahkan rujukan ke sumber tepercaya. Pernyataan tak bersumber bisa saja dipertentangkan dan dihapus.Cari sumber: Bayi – berita · surat kabar · buku · cendekiawan · JSTOR Artikel ini perlu dikembangkan agar dapat memenuhi kriteria sebagai entri Wikipedia.Bantulah untuk mengembangkan artikel ini. Jika tidak dikembangkan, ...

 

Cet article est une ébauche concernant un aéroport chinois. Vous pouvez partager vos connaissances en l’améliorant (comment ?) selon les recommandations des projets correspondants. Pour les articles homonymes, voir GMQ. Aéroport de Golog-Maqin果洛玛沁机场guǒluò măqìn jīchǎng Localisation Pays Chine Ville Golog Coordonnées 34° 25′ 17″ nord, 100° 18′ 06″ est Altitude 3 787 m (12 425 ft) Informations aéronautiques Code I...

 

Византийские монетные дворы — монетные дворы, учреждённые и действовавшие в Византийской империи. Кроме основных дворов в Константинополе и других крупных городах, существовало много мелких в провинциях. В большинстве своём такие малые дворы были основаны в VI веке, �...

For similarly named synagogues, see Beth Israel. Beth Israel Ner TamidHebrew: בית ישראלReligionAffiliationConservative JudaismEcclesiastical or organizational statusSynagogueLeadershipRabbi: Joel AlterCantor Jeremy SteinStatusActiveLocationLocation6880 North Green Bay Avenue,Glendale, Milwaukee, WisconsinCountryUnited StatesLocation in WisconsinAdministrationUnited Synagogue of Conservative JudaismGeographic coordinates43°08′32″N 87°56′02″W / 43.142111°N 87....

 

Piana degli Albanesicomune(IT) Comune di Piana degli Albanesi(AAE) Bashkia e Horës së Arbëreshëvet (dettagli) Piana degli Albanesi – VedutaPanorama di Piana degli Albanesi LocalizzazioneStato Italia Regione Sicilia Città metropolitana Palermo AmministrazioneSindacoRosario Petta (lista civica di centro-destra) dal 16-6-2022 TerritorioCoordinate38°00′N 13°17′E / 38°N 13.283333°E38; 13.283333 (Piana degli Albanesi)Coordinate: 38°00′N ...

 

Premier League Malti 1983-1984 Competizione Premier League Malti Sport Calcio Edizione 69ª Organizzatore MFA Luogo  Malta Partecipanti 8 Formula 1 girone all'italiana Risultati Vincitore  Valletta(12º titolo) Retrocessioni Template:Calcio St. Patrick's Birkirkara Statistiche Incontri disputati 153 Gol segnati 111 (0,73 per incontro) Cronologia della competizione 1982-83 1984-85 Manuale L'edizione 1983-1984 della Premier League maltese è stata la sessantanovesima edizio...

This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Maxwell Render – news · newspapers · books · scholar · JSTOR (April 2012) (Learn how and when to remove thi...

 

Fauna found in deep-sea areas Humpback anglerfish Deep-sea fish are fish that live in the darkness below the sunlit surface waters, that is below the epipelagic or photic zone of the sea. The lanternfish is, by far, the most common deep-sea fish. Other deep-sea fishes include the flashlight fish, cookiecutter shark, bristlemouths, anglerfish, viperfish, and some species of eelpout. Only about 2% of known marine species inhabit the pelagic environment. This means that they live in the water co...

 

Norman Hargreaves-MawdsleyBornWilliam Norman Hargreaves-Mawdsley(1921-11-13)13 November 1921Bristol, United KingdomDied11 April 1980(1980-04-11) (aged 58)Brandon, Manitoba, CanadaNationalityBritishOccupation(s)historian, scholar of legal and academic dressSpouseJosefina Laguens William Norman Hargreaves-Mawdsley (13 November 1921 – 11 April 1980) was a British historian, and expert on the history of legal and academic dress. Biography Hargreaves-Mawdsley was born in Bristol in 1921, w...

Disambiguazione – Se stai cercando altri significati, vedi Ars nova (disambigua). Questa voce è parte della serieStoria della musica Categoria:Storia della musica Categoria:Musica per anno Musica nel mondo antico · medievale · rinascimentale · barocca · classica · romantica · moderna · contemporanea Preistoria e antichità Musica preistorica - ante XXXV sec. a.C. Musica nel mondo antico - ca. XXXV sec. a.C. - V sec. d.C. Musica mesopotamica - ca. ...

 

Cinema of theUnited Kingdom List of British films British horror 1888–1919 1920s 1920 1921 1922 1923 19241925 1926 1927 1928 1929 1930s 1930 1931 1932 1933 19341935 1936 1937 1938 1939 1940s 1940 1941 1942 1943 19441945 1946 1947 1948 1949 1950s 1950 1951 1952 1953 19541955 1956 1957 1958 1959 1960s 1960 1961 1962 1963 19641965 1966 1967 1968 1969 1970s 1970 1971 1972 1973 19741975 1976 1977 1978 1979 1980s 1980 1981 1982 1983 19841985 1986 1987 1988 1989 1990s 1990 1991 1992 1993 19941995...

 

Hover cover at Lord's in 2008, with additional sheets rolled up on each side Traditional mobile covers being manually wheeled into place in a rain shower Wheeled covers and flat plastic covers in place during rain at the Oval, 2008 A hover cover is a specialised hovercraft used at major cricket grounds to cover and protect the cricket pitch from inclement weather, particularly showers of rain. The hover cover can be stored close to the edge of the cricket field, and when required can be moved...

В Википедии есть статьи о других людях с такой фамилией, см. Яновский; Яновский, Василий. Василий Иванович Яновский Дата рождения 11 мая 1828(1828-05-11) Дата смерти 9 сентября 1907(1907-09-09) (79 лет) Место смерти Ораниенбаум, Петергофский уезд, Санкт-Петербургская губерния, Российская...

 

Cet article est une ébauche concernant une écrivaine américaine. Vous pouvez partager vos connaissances en l’améliorant (comment ?) selon les recommandations des projets correspondants. Si ce bandeau n'est plus pertinent, retirez-le. Cliquez ici pour en savoir plus. Cet article ne cite pas suffisamment ses sources (février 2013). Si vous disposez d'ouvrages ou d'articles de référence ou si vous connaissez des sites web de qualité traitant du thème abordé ici, merci de compl�...