STK32C

STK32C
Ідентифікатори
Символи STK32C, PKE, YANK3, serine/threonine kinase 32C
Зовнішні ІД MGI: 2385336 HomoloGene: 75157 GeneCards: STK32C
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001162540
NM_021302
RefSeq (білок)
NP_001156012
NP_067277
Локус (UCSC) Хр. 10: 132.21 – 132.33 Mb Хр. 7: 138.68 – 138.79 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

STK32C (англ. Serine/threonine kinase 32C) – білок, який кодується однойменним геном, розташованим у людей на 10-й хромосомі.[3] Довжина поліпептидного ланцюга білка становить 486 амінокислот, а молекулярна маса — 54 994[4].

Послідовність амінокислот
1020304050
MRSGAERRGSSAAASPGSPPPGRARPAGSDAPSALPPPAAGQPRARDSGD
VRSQPRPLFQWSKWKKRMGSSMSAATARRPVFDDKEDVNFDHFQILRAIG
KGSFGKVCIVQKRDTEKMYAMKYMNKQQCIERDEVRNVFRELEILQEIEH
VFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVQFSEDTVRLYICEM
ALALDYLRGQHIIHRDVKPDNILLDERGHAHLTDFNIATIIKDGERATAL
AGTKPYMAPEIFHSFVNGGTGYSFEVDWWSVGVMAYELLRGWRPYDIHSS
NAVESLVQLFSTVSVQYVPTWSKEMVALLRKLLTVNPEHRLSSLQDVQAA
PALAGVLWDHLSEKRVEPGFVPNKGRLHCDPTFELEEMILESRPLHKKKK
RLAKNKSRDNSRDSSQSENDYLQDCLDAIQQDFVIFNREKLKRSQDLPRE
PLPAPESRDAAEPVEDEAERSALPMCGPICPSAGSG

Кодований геном білок за функціями належить до трансфераз, кіназ, серин/треонінових протеїнкіназ, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами, іонами металів, іоном магнію.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Manning G., Whyte D.B., Martinez R., Hunter T., Sudarsanam S. (2002). The protein kinase complement of the human genome. Science. 298: 1912—1934. PMID 12471243 DOI:10.1126/science.1075762

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:21332 (англ.) . Архів оригіналу за 30 червня 2017. Процитовано 19 вересня 2017.
  4. UniProt, Q86UX6 (англ.) . Архів оригіналу за 27 березня 2018. Процитовано 19 вересня 2017.

Див. також

Read other articles:

English inn in Southwark, London (1307–1676) The Tabard Inn, Southwark, around 1850 The Tabard was an inn in Southwark established in 1307 that stood on the east side of Borough High Street, at the road's intersection with the ancient thoroughfare to Canterbury and Dover. It was built for the Abbot of Hyde, who purchased the land to construct a place for himself and his ecclesiastical brethren to stay when on business in London. The Tabard was famous for accommodating people who made the pi...

Vuelo 1420 de American Airlines Restos del avión tras el accidenteFecha 1 de junio de 1999Hora 23:51[1]​Causa Error del piloto y condiciones meteorológicas adversasLugar Little Rock, Arkansas,  Estados UnidosCoordenadas 34°44′11″N 92°11′58″O / 34.736333333333, -92.1995Origen Aeropuerto Internacional de Dallas-Fort Worth, Dallas, TexasDestino Aeropuerto Nacional de Little Rock, Little Rock, ArkansasFallecidos 11Heridos 110ImplicadoTipo McDonnell Douglas M...

CycadophytaCycadopsidacicadas, cicas Cone de Cycas revoluta Classificação científica Reino: Plantae Divisão: Cycadophyta Classe: Cycadopsida Distribuição geográfica Ordens Cycadales As Cicadófitas (divisão Cycadophyta) são plantas tradicionalmente classificadas como gimnospérmicas, por produzirem sementes nuas, ou seja, não encerradas num ovário. São plantas com folhas coriáceas que se assemelham às das palmeiras - as de maiores dimensões - ou aos fetos (samambaias). Têm um ...

Olympic shooting event Women's trapat the Games of the XXXII OlympiadOlympic shooting pictogramVenueAsaka Shooting RangeDates28–29 July 2021Competitors26 from 19 nationsMedalists Zuzana Rehák-Štefečeková  Slovakia Kayle Browning  United States Alessandra Perilli  San Marino← 20162024 → Shooting at the2020 Summer OlympicsQualificationRifle50 m rifle three positionsmenwomen10 m air riflemenwomenmixedPistol25 m pistolwomen25 m rapid fire pisto...

Women's tennis tournament This article relies largely or entirely on a single source. Relevant discussion may be found on the talk page. Please help improve this article by introducing citations to additional sources.Find sources: 2005 Generali Ladies Linz – news · newspapers · books · scholar · JSTOR (September 2020) Tennis tournament2005 Generali Ladies LinzDate22 – 30 OctoberEdition19thCategoryTier II SeriesPrize moneyUSD $585,000SurfaceHard ...

1989 film by Mani Ratnam Geethanjali150 days running successfully Release posterDirected byMani RatnamWritten byMani Ratnam Dialogue byRajasri Produced byChittamuru Praveen Kumar ReddyStarringNagarjunaGirijaCinematographyP. C. SreeramEdited byB. LeninV. T. VijayanMusic byIlaiyaraajaProductioncompanyBhagyalakshmi EnterprisesDistributed byBhagyalakshmi EnterprisesRelease date 12 May 1989 (1989-05-12) Running time135 minutes[1]CountryIndiaLanguageTelugu Geethanjali is a 19...

Not to be confused with basanite or Bassanitae. BassaniteWhite radial-acicular bassanite crystals from Kimba, Eyre Peninsula, South AustraliaGeneralCategorySulfate mineralFormula(repeating unit)CaSO4·1/2H2OIMA symbolBss[1]Strunz classification7.CD.45Crystal systemMonoclinicSpace groupC2 (No. 5)Unit cella = 12.0317 Å, b = 6.9269 Å, c = 12.6712 Å, β = 90.27°; Z = 12IdentificationColorWhiteCrystal habitMicroscopic acicular crystals in parallel aggregates, p...

Penaklukan GurunPenaklukan Gurun oleh Juan Manuel Blanes (Julio Argentino Roca di latar depan)Tanggal1870-an – 1884LokasiPatagoniaHasil Argentina menang telakPerubahanwilayah Aneksasi Patagonia oleh ArgentinaPihak terlibat  ArgentinaSekutu Tehuelche MapucheTehuelcheTokoh dan pemimpin Julio Argentino Roca Conrado Villegas Manuel Namuncurá Penaklukan Gurun (Spanyol: Conquista del desierto) adalah kampanye militer pimpinan Jenderal Julio Argentino Roca pada tahun 1870-an yang bertuju...

Prototype suspended railway system For other uses of Skybus, see Skybus (disambiguation). Skybus MetroA Skybus Metro car at a stationOverviewArea servedMargao, GoaTransit typeSuspended railwayNumber of lines1Number of stations1OperationBegan operationNever entered serviceOperator(s)Konkan RailwayRolling stockBEMLTrain length18.5 m (61 ft)TechnicalSystem length1.6 km (0.99 mi)Minimum radius of curvature100 m (330 ft)Top speed100 km/h (62 mph) The Skybus ...

1999 studio album by Yat-KhaDalai BeldiriStudio album by Yat-KhaReleased1999LabelWicklow Records[1]ProducerLu EdmondsYat-Kha chronology Yenisei Punk(1995) Dalai Beldiri(1999) Aldyn Dashka(2000) Dalai Beldiri is an album by the Tuvan trio Yat-Kha.[2][3] It was released internationally in 1999.[4] The album title translates as the confluence of the seas.[5] The band supported the album with a North American tour.[6] Production The album wa...

مطار ليوناردو دا فينشي - فيوميتشينو L'aeroporto di Roma-Fiumicino Leonardo da Vinci إياتا: FCO – ايكاو: LIRF موجز نوع المطار عام المشغل مطارات روما (ش.م) يخدم روما البلد إيطاليا  الموقع فيوميتشينو -  إيطاليا الارتفاع 4.6 م؛ 15 قدم إحداثيات 41°48′01″N 012°14′20″E / 41.80028°N 12.23889°E / 41.80028; 12.23889 ال...

Tony AdamsMBE Adams di tahun 2010Informasi pribadiNama lengkap Tony Alexander Adams[1]Tanggal lahir 10 Oktober 1966 (umur 57)[1]Tempat lahir Romford, London, InggrisTinggi 1,91 m (6 ft 3 in)[1]Posisi bermain BekKarier junior1980–1983 ArsenalKarier senior*Tahun Tim Tampil (Gol)1983–2002 Arsenal 504 (32)Tim nasional1987–2000 Inggris 66 (5)Kepelatihan2003–2004 Wycombe Wanderers2008–2009 Portsmouth2010–2011 Gabala2016–2017 Granada * Penamp...

Ferries of New Jersey This article is about ferry/excursion boat operators in the Port of New York and New Jersey. For cruise ship company, see Princess Cruises. For the NYC Ferry line connecting South Brooklyn and the Rockaways, see NYC Ferry § Rockaway route. American Princess Cruises, based in Neponsit, Queens, United States under the TWFM Ferry Service, Inc.,[1] offers ferry, sightseeing, and yacht charter excursions in Long Island, New Jersey, and New York City. It is one o...

Эту страницу предлагается объединить со страницей ЯМЗ-236/238.Пояснение причин и обсуждение — на странице Википедия:К объединению/26 октября 2018.Обсуждение длится не менее недели (подробнее). Не удаляйте шаблон до подведения итога обсуждения. ЯМЗ-240 Двигатель ЯМЗ-240М. Музей ОА...

В Википедии есть статьи о других людях с такой фамилией, см. Петров; Петров, Павел; Петров, Павел Павлович. Для улучшения этой статьи желательно: Найти и оформить в виде сносок ссылки на независимые авторитетные источники, подтверждающие написанное.После исправления проб�...

PurabayaKecamatanPurabayaPeta lokasi Kecamatan PurabayaTampilkan peta Kabupaten SukabumiPurabayaPurabaya (Jawa Barat)Tampilkan peta Jawa BaratPurabayaPurabaya (Jawa)Tampilkan peta JawaPurabayaPurabaya (Indonesia)Tampilkan peta IndonesiaKoordinat: 7°06′31″S 106°52′44″E / 7.108602891665537°S 106.87888116851626°E / -7.108602891665537; 106.87888116851626Koordinat: 7°06′31″S 106°52′44″E / 7.108602891665537°S 106.87888116851626°E࿯...

Varsity team For men’s basketball team, see UST Growling Tigers basketball. UST Growling TigersSchoolUniversity of Santo TomasLeagueUAAPJoined1938(NCAA founding member–1924)LocationEspaña Boulevard, Sampaloc, Manila, PhilippinesTeam colorsGold, black, and white[1]     Women's teamTigressesJuniors' teamTiger CubsWebsitesportsinstitute.ust.edu.phSeniors' general championshipsUAAP: 45 1958–59 1960–61 1961–62 1962–63 1963–64 1964–65...

Atlas ILaunch of the maiden flight of the Atlas I, with the CRRES satelliteFunctionExpendable launch systemManufacturerGeneral DynamicsCountry of originUnited StatesSizeHeight43.90m (144.00 ft)Diameter3.05m (10 ft)Mass164,300kg (362,200 lb)Stages2.5Capacity Payload to 185 km (115 mi) LEOMass5,900 kg (13,000 lb)[1]Payload to GTOMass2,375 kg (5,236 lb)[2] Associated rocketsFamilyAtlasLaunch historyStatusRetiredLaunch sitesLC-36B, Cape CanaveralTotal...

Questa voce sull'argomento calciatori brasiliani è solo un abbozzo. Contribuisci a migliorarla secondo le convenzioni di Wikipedia. Segui i suggerimenti del progetto di riferimento. Vítor Tormena Nazionalità  Brasile Altezza 192 cm Calcio Ruolo Difensore Squadra  Krasnodar Carriera Giovanili  San Paolo Squadre di club1 2016 San Paolo0 (0)2017→  Grêmio Novorizontino0 (0)[1]2017-2018 Gil Vicente35 (1)2018-2019→  Portimonense26 (1)2019-2023...

Group C of the 2019 FIFA Women's World Cup took place from 9 to 18 June 2019.[1] The group consisted of Australia, Brazil, Italy and Jamaica.[2] The top two teams, Italy and Australia, along with the third-placed team, Brazil (as one of the four best third-placed teams), advanced to the round of 16.[3] Teams Draw position Team Pot Confederation Method ofqualification Date ofqualification Finalsappearance Lastappearance Previous bestperformance FIFA Rankings December 20...