CDKN2B

CDKN2B
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CDKN2B, CDK4I, INK4B, MTS2, P15, TP15, p15INK4b, cyclin-dependent kinase inhibitor 2B, cyclin dependent kinase inhibitor 2B
Зовнішні ІД OMIM: 600431 MGI: 104737 HomoloGene: 55859 GeneCards: CDKN2B
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_078487
NM_004936
NM_007670
RefSeq (білок)
NP_004927
NP_511042
NP_031696
Локус (UCSC) Хр. 9: 22 – 22.01 Mb Хр. 4: 89.22 – 89.23 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CDKN2B (англ. Cyclin dependent kinase inhibitor 2B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 138 амінокислот, а молекулярна маса — 14 722[4].

Послідовність амінокислот
1020304050
MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRA
IQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLH
RAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD

Задіяний у таких біологічних процесах, як клітинний цикл, альтернативний сплайсинг. Локалізований у цитоплазмі.

Література

  • Hannon G.J., Beach D. (1994). p15INK4B is a potential effector of TGF-beta-induced cell cycle arrest. Nature. 371: 257—261. PMID 8078588 DOI:10.1038/371257a0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Yuan C., Selby T.L., Li J., Byeon I.J., Tsai M.D. (2000). Tumor suppressor INK4: refinement of p16INK4A structure and determination of p15INK4B structure by comparative modeling and NMR data. Protein Sci. 9: 1120—1128. PMID 10892805 DOI:10.1110/ps.9.6.1120
  • Tsubari M., Tiihonen E., Laiho M. (1997). Cloning and characterization of p10, an alternatively spliced form of p15 cyclin-dependent kinase inhibitor. Cancer Res. 57: 2966—2973. PMID 9230210

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:1788 (англ.) . Архів оригіналу за 16 березня 2016. Процитовано 8 вересня 2017.
  4. UniProt, P42772 (англ.) . Архів оригіналу за 26 вересня 2017. Процитовано 8 вересня 2017.

Див. також

Read other articles:

Neighborhood book exchange nonprofit Little Free Library Ltd.A Little Free LibraryFounded2009 (2009)FounderTodd BolType501(c)(3) nonprofit organization[1]Tax ID no. 45-4043708[2]PurposeTo be a catalyst for building community, inspiring readers, and expanding book access for all through a global network of volunteer-led Little Free Libraries. [3]HeadquartersSt. Paul, MinnesotaExecutive DirectorGreig Metzger[4]Revenue (2021) $4,350,241[5]Expenses (20...

هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (مارس 2018) أبولو كورزينيويسكي   معلومات شخصية الميلاد 21 فبراير 1820[1]  الوفاة 23 مايو 1869 (49 سنة) [1]  كراكوف  مكان الدفن مقبرة راكوفيسكي  مواطنة بولندا ال�...

Geert Mul Geert Mul, 2015 Persoonsgegevens Volledige naam Gerardus Nicolaas Maria Mul Geboren 11 oktober 1965 Geboorteland  Nederland Beroep(en) Mediakunstenaar RKD-profiel Officiële website Portaal    Kunst & Cultuur Gerardus Nicolaas Maria (Geert) Mul (Alphen aan den Rijn, 11 oktober 1965) is een Nederlands mediakunstenaar. Hij vervaardigt sculpturen, projecties, generatieve en interactieve audiovisuele installaties voor talloze locaties, waaronder scholen, een geme...

Urso-polar Indivíduo nas proximidades de Kaktovik, Ilha Barter, Alasca. Estado de conservação Vulnerável (IUCN 3.1) [1] Classificação científica Reino: Animalia Filo: Chordata Classe: Mammalia Ordem: Carnivora Família: Ursidae Género: Ursus Espécie: U. maritimus Nome binomial Ursus maritimusPhipps, 1774 Distribuição geográfica Distribuição do urso-polar (em verde). Sinónimos Sinonímia da espécie[2] Ursus marinus Pallas, 1776 Ursus polaris Shaw, 1792 Thalassarctos eogroenland...

2000 video gameBreath of Fire IVNorth American PlayStation cover artDeveloper(s)Capcom Development Studio 3Publisher(s)WW: CapcomJP: SourceNext (PC)Producer(s)Hironobu TakeshitaDesigner(s)Makoto IkeharaArtist(s)Tatsuya YoshikawaWriter(s)Makoto IkeharaComposer(s)Yoshino AokiTaro Iwashiro (opening)SeriesBreath of FirePlatform(s)PlayStation, WindowsReleasePlayStationJP: April 27, 2000NA: November 29, 2000[1]EU: August 3, 2001Microsoft WindowsJP: May 30, 2003EU: September 10, 2003Genre(s)...

1991 single by DivinylsI'm on Your SideSingle by Divinylsfrom the album Divinyls B-sideI Touch Myself (Live)Released9 September 1991[1]Recorded1990StudioGroove Masters, Santa MonicaGenreSoft rockLength4:16LabelVirgin RecordsSongwriter(s) Billy Steinberg Tom Kelly Producer(s)Christina AmphlettMark McEnteeDavid TickleDivinyls singles chronology Make Out Alright (1991) I'm on Your Side (1991) I Ain't Gonna Eat Out My Heart Anymore (1992) I'm on Your Side is a ballad performed by Australi...

American advertising cartoon mascot For people with the nickname Tony the Tiger, see Tony the Tiger (disambiguation). Fictional character Tony the TigerConcept art for Chuck Gammage Animation by Daryl GrahamCreated byThe Kellogg CompanyVoiced byDallas McKennon (1952–1953)Thurl Ravenscroft (1953–2005) (US), (1953–1999) (UK)Lee Marshall (1999–2005; Understudy and Singing voice, 2005–2014; full-time)Tex Brashear (2014–present)Tony Daniels (2005–present) (Canada)Tom Clarke Hill (199...

Specialised agency of the United Nations WIPO redirects here. For other uses, see Wipo. World Intellectual Property OrganizationAbbreviationWIPOFormation14 July 1967; 56 years ago (1967-07-14)TypeUnited Nations specialised agencyLegal statusActiveHeadquartersGeneva, SwitzerlandMembership 193 member statesHeadDaren TangDirector GeneralParent organizationUnited Nations Economic and Social CouncilWebsitewipo.int Politics portal The United Nations Office at Geneva (Swit...

Turkic ethnic group Coin of Tegin Shah, described as Iltäbar (sub-King) of the Khalaj, dated to the year 728 CE, on the Hephthalite model, imitating Sasanian king Peroz I (438-457).Obverse: Crown with tridents and lion head. Brahmi inscription around (starting 11:00): sri-hitivira kharalava parame – svara sri sahi tiginadeva karita (His Excellency, Iltäbär of Khalaj, worshipper of the Supreme God, His Excellency the King, the divine Lord Tegin had minted this coin). Inside, Bactrian insc...

This article does not cite any sources. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Assembly of North Macedonia – news · newspapers · books · scholar · JSTOR (January 2023) (Learn how and when to remove this template message) Legislature of North Macedonia Assembly of the Republic ofNorth Macedonia Собрание / KuvendiTypeTypeUnicameral Established1990 ...

International athletics championship event53rd South American ChampionshipsDates28–30 JulyHost citySão Paulo, BrazilVenueCOTPLevelSeniorEvents45 (22 men, 22 women, 1 mixed)Participation370 athletes from 13 nations← 2021 Guayaquil 2025 → 2023 South American Championships in Athletics will be the 53rd edition of the biennial athletics competition between South American nations. The event will be held in São Paulo, Brazil, from 28 to 30 July at the Estádio Ícaro de Castro Melo....

ليونور، أميرة أستورياس   معلومات شخصية الميلاد 10 سبتمبر 1423  بلد الوليد  الوفاة 22 أغسطس 1425 (1 سنة)   كاسترومونتي  مواطنة تاج قشتالة  الأب خوان الثاني ملك قشتالة  الأم ماريا من أراغون، ملكة قشتالة  إخوة وأخوات إنريكي الرابع ملك قشتالة،  وألفونسو، أمير أست...

Far-right Three Percenters patrol Emancipation Park in Charlottesville, Virginia during the 2017 Unite the Right rally. American conservative political movement This article is part of a series onConservatismin the United States Schools Compassionate Fiscal Fusion Libertarian Moderate Movement Neo Paleo Progressive Social Traditionalist Principles American exceptionalism Anti-communism Christian nationalism Classical liberalism Constitutionalism Family values Judeo-Christian values Limited go...

American gospel group founded by Max and Lucy Mace This article relies excessively on references to primary sources. Please improve this article by adding secondary or tertiary sources. Find sources: Heritage Singers – news · newspapers · books · scholar · JSTOR (May 2019) (Learn how and when to remove this template message) Rhonda Ramsey was forgotten in past members of the heritage singers. Heritage SingersBackground informationOriginPlacerville, Cal...

Mexican folk art sculptures Alebrijes at the Pochote Market in the city of Oaxaca Zacualpan Mojiganga 070 Animation clip (in Spanish) about alebrijes made by the Museo de Arte Popular in collaboration with Wiki Learning, Tec de Monterrey Alebrijes (Spanish pronunciation: [aleˈβɾixes]) are brightly colored Mexican folk art sculptures of fantastical (fantasy/mythical) creatures. Description The first alebrijes originated in Mexico City, originally created by 'cartonero' artist ' Pedr...

Voce principale: Charles Villiers Stanford. Stanford a fine Ottocento. Lista delle composizioni di Charles Villiers Stanford (1852-1924), ordinate per genere. Indice 1 Opere 2 Composizioni per orchestra 2.1 Sinfonie 2.2 Concerti 2.3 Rapsodie irlandesi 2.4 Altre composizioni per orchestra 3 Composizioni per coro 3.1 Anthem e mottetti 3.2 Service 3.3 Miscellanea 3.4 Composizioni per coro e orchestra 3.5 Canzoni per sole voci e pianoforte 4 Musica da camera 5 Musica per pianoforte 6 Musica per o...

Kyokushin Air IATA ICAO Callsign - KOK - Ceased operationsOctober 1, 2008Operating basesSado AirportFleet sizeBritten-Norman IslanderDestinationsNiigata AirportHeadquartersSado Island, Japan Britten Norman Islander Kyokushin Air (旭伸航空, Kyokushin Kōkū) was a commuter airline serving visitors and residents of Sado Island, Niigata Prefecture, Japan. It commuted between Sado Island and Niigata Airport. The airline used Britten-Norman BN2 Islander aircraft for its services. The airline c...

Voce principale: Unione Sportiva Grosseto Football Club. Unione Sportiva GrossetoStagione 1977-1978Sport calcio Squadra Grosseto Allenatore Nilo Palazzoli Presidente Mario Ferri Serie C17º posto nel girone B. Retrocesso in Serie C2. Maggiori presenzeCampionato: Brezzi, Ciavattini (37) Miglior marcatoreCampionato: Mencio (5) 1976-1977 1978-1979 Si invita a seguire il modello di voce Questa pagina raccoglie le informazioni riguardanti l'Unione Sportiva Grosseto nelle competizioni ufficial...

PeritName in hieroglyphs [1] Perit is an underworld deity in Egyptian mythology.[2] She is one of the twelve goddesses in the ninth sector of Duat.[3] She utters words that give life and strength to Osiris.[2] References ^ Budge, E. A. Wallis; Budge, Sir Ernest Alfred Wallis (1996-01-01). The Egyptian Heaven and Hell. Courier Corporation. p. 197. ISBN 978-0-486-29368-4. ^ a b Coulter, Charles Russell; Turner, Patricia (2013-07-04). Encyclopedia of Anc...

You can help expand this article with text translated from the corresponding article in Russian. (March 2016) Click [show] for important translation instructions. Machine translation, like DeepL or Google Translate, is a useful starting point for translations, but translators must revise errors as necessary and confirm that the translation is accurate, rather than simply copy-pasting machine-translated text into the English Wikipedia. Consider adding a topic to this template: there are a...