ANKRD9

ANKRD9
Ідентифікатори
Символи ANKRD9, ankyrin repeat domain 9
Зовнішні ІД MGI: 1921501 HomoloGene: 17549 GeneCards: ANKRD9
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_152326
NM_001348651
NM_001348652
NM_175207
NM_001361916
NM_001361917
RefSeq (білок)
NP_689539
NP_001335580
NP_001335581
NP_780416
NP_001348845
NP_001348846
Локус (UCSC) Хр. 14: 102.5 – 102.51 Mb Хр. 12: 110.94 – 110.95 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ANKRD9 (англ. Ankyrin repeat domain 9) – білок, який кодується однойменним геном, розташованим у людей на 14-й хромосомі.[3] Довжина поліпептидного ланцюга білка становить 317 амінокислот, а молекулярна маса — 34 295[4].

Послідовність амінокислот
1020304050
MPWDARRPGGGADGGPEASGAARSRAQKQCRKSSFAFYQAVRDLLPVWLL
EDMRASEAFHWDERGRAAAYSPSEALLYALVHDHQAYAHYLLATFPRRAL
APPSAGFRCCAAPGPHVALAVRYNRVGILRRILRTLRDFPAEERARVLDR
RGCSRVEGGGTSLHVACELARPECLFLLLGHGASPGLRDGGGLTPLELLL
RQLGRDAGATPSAAGAPASAPGEPRQRRLLLLDLLALYTPVGAAGSARQE
LLGDRPRWQRLLGEDKFQWLAGLAPPSLFARAMQVLVTAISPGRFPEALD
ELPLPPFLQPLDLTGKG

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:20096 (англ.) . Архів оригіналу за 16 липня 2017. Процитовано 20 вересня 2017.
  4. UniProt, Q96BM1 (англ.) . Архів оригіналу за 5 травня 2016. Процитовано 20 вересня 2017.

Див. також

Read other articles:

Artikel ini bukan mengenai Rumapea. Keduanya merupakan marga yang berbeda tanpa hubungan kekerabatan. Untuk marga Hutapea keturunan Hutatoruan, lihat Hutapea (Si Opat Pisoran).HutapeaTugu Ompu Raja Hutapea di Laguboti.Aksara Batakᯂᯮᯖᯇᯩᯀ (Surat Batak Toba)Nama margaHutapeaSilsilahJarakgenerasi denganSiraja Batak1Si Raja Batak2Raja Isumbaon3Tuan Sorimangaraja4Tuan Sorbadibanua (Nai Suanon)5Sipaettua6Puraja Laguboti (Pardungdang)7HutapeaNama lengkaptokohOmpu Raja HutapeaNama istribor...

Bursa Efek AustraliaAustralian Securities ExchangeJenisBursa sahamLokasiSydney, AustraliaDidirikan1987PemilikASX LimitedMata uangDolar AustraliaEmiten tercatat2,122 (Januari 2013)[1]Kapitalisasi pasar$1,4 trilyun (Januari 2013)[1]Situs webwww.asx.com.au ASX LimitedJenisPublikKode emitenASX: ASXIndustriPasar sekuritasDidirikan1987, tapi dating kembali ke tahun 1861KantorpusatSydney, AustraliaTokohkunciRick Holliday-Smith, (Ketua)Elmer Funke Kupper, (CEO dan Direktur M...

هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (يونيو 2022) اضغط هنا للاطلاع على كيفية قراءة التصنيف كثاء   المرتبة التصنيفية جنس  التصنيف العلمي  فوق النطاق  حيويات مملكة عليا  حقيقيات النوى مملكة  نبات

Опис Меморіал Людмили Руснак 2014.jpg Джерело Власний архів Час створення червень 2014 р. Автор зображення Lorry Ліцензія дивись нижче Ліцензування Цей твір поширюється на умовах ліцензії Creative Commons Attribution-Share Alike 3.0 Unported. Коротко: ви можете вільно поширювати цей твір, зм�...

بندر أمجز بندرامجز  - قرية -  تقسيم إداري البلد  إيران المحافظة كرمان المقاطعة عنبر أباد الناحية الناحية المركزية (مقاطعة عنبر أباد) القسم الريفي قسم أمجز الريفي (مقاطعة عنبر أباد) السكان معلومات أخرى التوقيت توقيت إيران (+3:30 غرينيتش) توقيت صيفي توقيت إيران (+4:30) �...

Early U.S. flag design Betsy Ross FlagUseProportion10:19Adopted1777DesignThirteen alternating red and white stripes, a blue canton with thirteen 5-pointed stars arranged in a circleDesigned byVarious The Betsy Ross flag is a reconstructed early design for the flag of the United States, which is conformant to the Flag Act of 1777 and has red stripes outermost and stars arranged in a circle. These details elaborate on the 1777 act, passed early in the American Revolutionary War, which spec...

Japanese politician (1885–1952) Haru WazakiMember of the House of RepresentativesIn office1946–1947ConstituencyAkita Personal detailsBorn1 February 1885Akita, JapanDied30 December 1952(1952-12-30) (aged 67) Haru Wazaki (Japanese: 和崎ハル, 1 February 1885 – 30 December 1952) was a Japanese politician. She was one of the first group of women elected to the House of Representatives in 1946.[1] Biography Born in Akita in 1885, Wazaki was educated at Akita Girls' High Schoo...

Archaeology museum, Ethnographic museum in Amasya, TurkeyAmasya MuseumAmasya MüzesiLocation of Amasya Museum in TurkeyEstablished1958; 65 years ago (1958)LocationMustafa Kemal Paşa Cad., Amasya, TurkeyCoordinates40°38′58″N 35°49′29″E / 40.64944°N 35.82472°E / 40.64944; 35.82472TypeArchaeology museum, Ethnographic museumCollectionsEarly Bronze Age, Hittites, Kingdom of Urartu Phrygians, Scythians, Hellenistic period, Roman Empire, Byzanti...

Church in Brussels, Belgium Church in Brussels-Capital Region, BelgiumChurch of Our Lady of LaekenFrench: Église Notre-Dame de LaekenDutch: Onze-Lieve-Vrouwekerk van LakenChurch of Our Lady of Laeken50°52′44″N 4°21′22″E / 50.879°N 4.356°E / 50.879; 4.356LocationLaeken, City of Brussels, Brussels-Capital RegionCountryBelgiumDenominationRoman CatholicWebsiteOfficial websiteHistoryStatusParish churchArchitectureFunctional statusActiveArchitect(s)Joseph Poelae...

2016 film directed by Raj Chakraborty AbhimaanTheatrical release posterDirected byRaj ChakrabortyBased onAttarintiki DarediProduced byReliance EntertainmentGrassroot EntertainmentWalzen Media WorksStarring Jeet Subhashree Ganguly Sayantika Banerjee Music bySuddho RoyProductioncompaniesGrassroot EntertainmentReliance EntertainmentWalzen Media WorksRelease dates 6 October 2016 (2016-10-06) (India) 30 December 2016 (2016-12-30) (Bangladesh) Running time132 m...

Museo de Historia Natural de la Sábana Museo de Historia Natural de la SábanaUbicaciónPaís Colombia ColombiaLocalidad NemocónDirección Calle 2 N.º 0-05 Barrio SalinasHistoria y gestiónInauguración 30 de abril de 2010 (12 años)Administrador Ministerio de Cultura de Colombia y Administración Municipal de Nemocón[1]​Director Ana María GrootInformación del edificioEdificio Antiguos talleres de metal mecánica de la Mina de Sal de NemocónInformación para visitantesHorari...

Japanese economist (1936–2023) Makoto ItohBorn(1936-04-20)April 20, 1936Tokyo, JapanDiedFebruary 7, 2023(2023-02-07) (aged 86)Academic careerFieldMarxian economicsSchool ortraditionMarxian economicsInfluencesKozo Uno, Karl Marx Makoto Itoh (伊藤 誠, Itō Makoto, April 20, 1936 – February 7, 2023) was a Japanese economist who was considered internationally to be one of the most important scholars of Karl Marx's theory of value. He taught at Kokugakuin University, Tokyo, and wa...

Cet article est une ébauche concernant la Haute-Saône. Vous pouvez partager vos connaissances en l’améliorant (comment ?) selon les recommandations des projets correspondants. Si ce bandeau n'est plus pertinent, retirez-le. Cliquez ici pour en savoir plus. Cet article doit être actualisé (mars 2016). Des passages de cet article ne sont plus d’actualité ou annoncent des événements désormais passés. Améliorez-le ou discutez-en. Vous pouvez également préciser les sections �...

Egyptian actor (born 1978) Youssef El SherifEl Sherif in an interview with Akhbar el-Yom TVBornMohamed Ismail Naji (1978-09-14) 14 September 1978 (age 45)Cairo, EgyptOther namesYoussef ElSherifOccupationActorYears active2003–presentWorksThe EndLe ChaosSpouse Engy Alaa ​(m. 2009)​Children3 Youssef El Sherif (Arabic: يوسف الشريف; born September 14, 1978);[1] is an Egyptian actor. His birth name is Mohamed Ismail Naji (Arabic: مح�...

American politician This article relies largely or entirely on a single source. Relevant discussion may be found on the talk page. Please help improve this article by introducing citations to additional sources.Find sources: Silas L. Niblack – news · newspapers · books · scholar · JSTOR (July 2019) Silas Leslie Niblack Silas Leslie Niblack (March 17, 1825 – February 13, 1883) was a Democratic U.S. Representative from Florida. He was the cousin of Wil...

Batalyon Kavaleri 11/SerbuMacan Setia CaktiLambang Yonkav 11/Macan Setia CaktiAktif16 Mei 2005CabangKavaleriTipe unitSatuan Bantuan TempurPeranPasukan Lapis BajaBagian dariKodam Iskandar MudaMarkasKota Jantho, Kabupaten Aceh Besar, AcehJulukanYonkav 11 /MSCMotoJaya dimasa Perang, Berguna dimasa DamaiBaretHitamMaskotHarimau SumateraUlang tahun16 MeiAlutsistaTank AMX-13 75mm, Tank AMX-13 105mm, Tank AMX-13 APC, Panser Anoa dan Panser APR Batalyon Kavaleri 11/Macan Setia Cakti atau Yon Kav 11/Se...

This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Walloon forge – news · newspapers · books · scholar · JSTOR (January 2021) (Learn how and when to remove this template message) Inside a walloon forge at Österbybruk A schematic diagram of a Walloon hearth as used in Sweden A Walloon forge (or Walloon process)...

Neural plateNeural crestDetailsCarnegie stage9Days19PrecursorectodermGives rise toneural foldsSystemCentral nervous systemIdentifiersLatinlamina neuralisMeSHD054258TEplate_by_E5.13.1.0.1.0.1 E5.13.1.0.1.0.1 Anatomical terminology[edit on Wikidata] The neural plate is a key developmental structure that serves as the basis for the nervous system. Cranial to the primitive node of the embryonic primitive streak, ectodermal tissue thickens and flattens to become the neural plate. The region an...

Institut NIOD untuk Pembelajaran Perang, Holokaus dan GenosidaPendahuluInstitut Belanda untuk Dokumentasi PerangPusat untuk Pembelajaran Holokaus dan GenosidaTanggal pendirian1945Kantor pusatAmsterdamLokasiBelandaSitus webwww.niod.nl Institut NIOD untuk Pembelajaran Perang, Holokaus dan Genosida (Belanda: NIOD Instituut voor Oorlogs-, Holocaust- en Genocidestudies) adalah sebuah organisasi di Belanda yang berfokus pada arsip-arsip dan pembelajaran sejarah dalam Perang Dunia Kedua. Institut te...

Species of fish Sebastes diaconus Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Chordata Class: Actinopterygii Order: Scorpaeniformes Family: Scorpaenidae Genus: Sebastes Species: S. diaconus Binomial name Sebastes diaconusFrable, D. W. Wagman, Frierson, A. Aguilar & Sidlauskas, 2015[1] Sebastes diaconus, the deacon rockfish, is a species of marine ray-finned fish belonging to the subfamily Sebastinae, the rockfishes, part of the family Scorpaenidae. I...