Read other articles:

قرية صقيت(تجمعات بدويه)  - قرية -  تقسيم إداري البلد  اليمن المحافظة محافظة المهرة المديرية مديرية الغيظة العزلة عزلة الغيظة السكان التعداد السكاني 2004 السكان 30   • الذكور 15   • الإناث 15   • عدد الأسر 5   • عدد المساكن 5 معلومات أخرى التوقيت توقيت اليمن (+3...

Velická dolina Die Velická dolina mit dem Berghotel Sliezsky dom, im Hintergrund der Seitengrat Velické granáty Die Velická dolina mit dem Berghotel Sliezsky dom, im Hintergrund der Seitengrat Velické granáty Lage Prešovský kraj, Slowakei Gewässer Velický potok Gebirge Hohe Tatra, Tatra, Karpaten Geographische Lage 49° 9′ 14″ N, 20° 9′ 30″ O49.15388888888920.158333333333Koordinaten: 49° 9′ 14″ N, 20° 9′ 30

Die Kreuznacher Straßen- und Vorortbahnen verbanden die Stadt Bad Kreuznach mit der Nachbarstadt Bad Münster am Stein, mit Langenlonsheim und Sankt Johann. Sie wurden elektrisch betrieben und waren nicht identisch mit den nicht elektrifizierten Kreuznacher Kleinbahnen. Straßenbahn auf dem Platz vor dem Stadthaus Inhaltsverzeichnis 1 Geschichte 1.1 Planung 1.2 Die erste Linie 1.3 Erweiterungen 1.4 Umstrukturierung 1.5 Verkleinerung 1938 1.6 Ende 2 Strecken 2.1 Kreuznach–Bad Münster (Lini...

1937 film The Priest from KirchfeldDirected byJacob FleckLuise FleckWritten byLudwig Anzengruber (play)Hubert FrohnProduced byLeo BergStarringHans JarayHansi StorkLudwig StösselCinematographyErnst MühlradMusic byViktor AltmannKarl M. MayProductioncompanyExcelsior FilmDistributed byKarl Philipp VerleihRelease date 18 November 1937 (1937-11-18) Running time81 minutesCountryAustriaLanguageGerman The Priest from Kirchfeld (German: Der Pfarrer von Kirchfeld) is a 1937 Austrian fil...

You'll Be in My HeartLagu oleh Phil Collinsdari album Tarzan: An Original Walt Disney Records SoundtrackSisi-BTrashin' the CampDirilis15 Juni 1999[1]FormatSingel CDDirekam1998Durasi4:17LabelWalt DisneyPenciptaPhil Collins[2]ProduserPhil Collins, Rob Cavallo You'll Be in My Heart adalah lagu Phil Collins, dari film animasi Disney tahun 1999 Tarzan.[2] Lagu ini muncul pada Soundtrack Tarzan: An Original Walt Disney Records serta berbagai kompilasi Disney lainnya. Versi s...

Hackers PaOlehPoster karya Dawn Patrol[1]Sutradara Iain Softley Produser Michael Peyser Ralph Winter Ditulis oleh Rafael Moreu Pemeran Jonny Lee Miller Angelina Jolie Fisher Stevens Lorraine Bracco Penata musikSimon BoswellSinematograferAndrzej SekułaPenyunting Chris Blunden Martin Walsh DistributorUnited ArtistsTanggal rilis 15 September 1995 (1995-09-15) (Amerika Serikat) Durasi107 menitNegara Indonesia Bahasa Sunda Anggaran$20 jutaPendapatankotor$7.5 juta (domestik)...

HanzeiKaisar JepangBerkuasa406 – 410 (tradisional)[1]PendahuluRichūPenerusIngyōKelahiranlegendaKematianlegendaPemakamanMozu no Mimihara no naka no misasagi (Osaka)Kaisar Hanzei (反正天皇code: ja is deprecated , Hanzei-tennō), dikenal juga sebagai Kaisar Hanshō, adalah kaisar Jepang ke-18.[2] Permaisuri dan Anak Permaisuri: Tsunohime (津野媛), putri dari Ooyake no omi Kogoto (大宅臣木事) Putri Kaihime (香火姫皇女) Putri Tuburahime (円皇女) Otohime (弟...

Union United States Army general George WrightBorn(1803-10-22)October 22, 1803Norwich, VermontDiedJuly 30, 1865(1865-07-30) (aged 61)Brother Jonathan, near Crescent City, CaliforniaPlace of burialSacramento Historic City Cemetery, Sacramento, CaliforniaAllegianceUnited States of AmericaUnionService/branchUnited States ArmyUnion ArmyYears of service1822–1865Rank Brigadier GeneralCommands held9th Infantry RegimentDepartment of OregonDistrict of Southern CaliforniaDepartment of the P...

This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Encyclopedia Magica – news · newspapers · books · scholar · JSTOR (April 2019) (Learn how and when to remove this template message) Encyclopedia Magica Volume OneGenreRole-playing gamesPublisherTSRPublication date1994–1995 Volume Two Volume Three Volume Four ...

Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...

This article is an orphan, as no other articles link to it. Please introduce links to this page from related articles; try the Find link tool for suggestions. (October 2017) Paula Jordan (née Frank; 17 May 1889 – 25 November 1941) was a German Jewish art dealer who was murdered in the Holocaust. Life and death Paula Frank was born in Steinach an der Saale as daughter of the Jewish merchant Lazarus Frank. During World War I she served as a nurse. On 16 December 1921 she married Siegfried Jo...

Species of spider This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Texas brown tarantula – news · newspapers · books · scholar · JSTOR (February 2011) (Learn how and when to remove this template message) Aphonopelma hentzi Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Arthropoda Subphy...

Tennis player statistics Career finals Discipline Type Won Lost Total WR Singles Grand Slam 1 1 2 0.50 Summer Olympics 0 1 1 0.00 WTA Finals – – – – WTA Elite Trophy – – – – WTA 1000[a] – – – – WTA 500[b] & 250[c] 1 2 3 0.33 Total 2 4 6 0.33 Doubles Grand Slam – – – – Summer Olympics – – – – WTA Finals – – – – WTA 1000[a] 0 1 1 0.00 WTA 500[b] & 250[c] 0 2 2 0.00 Total 0 3 3 0.00 Total 2 7 ...

Artikel ini tidak memiliki bagian pembuka yang sesuai dengan standar Wikipedia. Mohon tulis paragraf pembuka yang informatif sehingga pembaca dapat memahami maksud dari Bendera Utrecht. Contoh paragraf pembuka Bendera Utrecht adalah .... (Pelajari cara dan kapan saatnya untuk menghapus pesan templat ini) Bendera Utrecht (rasio 2:3) Bendera Utrecht (Belanda: vlag van Utrecht) telah digunakan sejak 1952. Terdiri dari dua garis horizontal berukuran sama, putih di atas dan merah di bawah. Sam...

Former local gov. district in Scotland 56°11′N 3°05′W / 56.18°N 3.09°W / 56.18; -3.09 KirkcaldyDistrictKirkcaldy Town HouseKirkcaldy district within ScotlandPopulation • 1994148,450 History • Created16 May 1975 • Abolished31 March 1996 • Succeeded by(Part of) Fife GovernmentKirkcaldy District Council • HQKirkcaldy Kirkcaldy (Scottish Gaelic: Dùn Phàrlain, Scots: Dunfaurlin) was a local governmen...

Kachin classical singer This article is an orphan, as no other articles link to it. Please introduce links to this page from related articles; try the Find link tool for suggestions. (February 2023) Uyen Sinwa Nhpan Ja Ra (Burmese: အင်ဖန်းဂျာရာ; 1932 − 9 January 2023) was a Kachin classical singer who is regarded as the 'mother of Kachin art'.[1][2] Career Uyen sang the song of honor at the signing of the Panglong Agreement in 1947. In 1948, she becam...

Markus Wasmeier Data i miejsce urodzenia 9 września 1963 Schliersee Klub SC Schliersee Debiut w PŚ 5.02 1983, St. Anton(49. – zjazd) Pierwsze punkty w PŚ 29.01 1984, Ga-Pa(10. – kombinacja) Pierwsze podium w PŚ 11.12 1984, Sestriere (2. – gigant) Pierwsze zwycięstwo w PŚ 9.02 1986, Morzine(supergigant) Dorobek medalowy Reprezentacja  Niemcy Igrzyska olimpijskie złoto Lillehammer 1994 Supergigant złoto Lillehammer 1994 Gigant Mistrzostwa świata złoto Bormio 1985 Giga...

Questa voce o sezione sugli argomenti militari e politici pakistani non cita le fonti necessarie o quelle presenti sono insufficienti. Puoi migliorare questa voce aggiungendo citazioni da fonti attendibili secondo le linee guida sull'uso delle fonti. Segui i suggerimenti del progetto di riferimento. Pervez Musharraf Presidente del PakistanDurata mandato20 giugno 2001 –18 agosto 2008 Capo del governoZafarullah Khan Jamali Chaudhry Shujaat Hussain Shaukat Aziz Muhammad Mia...

Мессімі-сюр-СонMessimy-sur-Saône Країна  Франція Регіон Овернь-Рона-Альпи  Департамент Ен  Округ Бург-ан-Бресс Кантон Сен-Трив'є-сюр-Муаньян Код INSEE 01243 Поштові індекси 01480 Координати 46°03′00″ пн. ш. 4°45′51″ сх. д.H G O Висота 168 - 226 м.н.р.м. Площа 5,95 км² Населення 1288 (01.01...

Swedish actor (1829–1899) Knut Almlöf Knut Almlöf (9 February 1829 Stockholm – 3 January 1899, Almnäs, Gripsholm), was a Swedish stage actor. He was an elite actors of the Royal Dramatic Theatre and one of the most famed actors of his time in Sweden. Life Almlöf was the son of the actors Nils Almlöf and Brita Catharina Cederberg. He had an early enthusiasm to become an actor. His father, one of his country's most famous actors, did not want him to become an actor, and sent him to be ...