Share to: share facebook share twitter share wa share telegram print page

Célestin Lainé

Célestin Lainé
Célestin Lainé in 1944
Native name
Neven Hénaff
Born25 October 1908
Nantes, France
Died7 October 1983 (aged 74)
Ireland
AllegianceBreton
Service/branchMilitia
CommandsBezen Perrot
Battles/warsSecond World War
Alma materÉcole Centrale Paris
Other workChemical engineer

Célestin Lainé (25 October 1908 – 7 October 1983) was a Breton nationalist and collaborator during the Second World War who led the SS affiliated Bezen Perrot militia. His Breton language name is Neven Hénaff. He was a chemical engineer by training. After the war he moved to Ireland.

Breton nationalism

the Monument to the Union of Brittany and France, destroyed by Lainé in 1932.

He was born in 1908 in Nantes and was brought up in Ploudalmézeau, Finistère. He later entered the École Centrale. He became closely linked to Guillaume Berthou, a fellow chemist and Breton separatist. Contrary to myth, he denied any involvement with the secret society Kentoc'h Mervel (Sooner Death), formed by Berthou in 1929, though Berthou had approached him to join.[1] Instead, in 1930 he set up with Hervé Helloco the paramilitary organisation, Gwenn ha du ('white and black'). It was named after the colours of the flag of Brittany, designed by Morvan Marchal in 1925.[2] Lainé published an article summarizing its creed under the title Nos deux bases, Irlande et Prusse (Our two models: Ireland and Prussia), referring to the revolutionary zeal of the IRA and the authoritarian discipline of Prussian militarism. The gang perpetrated several bombings. Lainé claimed he made the first bomb in his bedroom from nitroglycerin in a condensed milk carton with a detonator supplied by a forestry worker.

Kristian Hamon claims it was not he but fellow nationalist André Geffroy who placed the bomb which blew up Jean Boucher's statue depicting the Unity of Brittany and France in Rennes. It happened on the morning of 7 August 1932. According to Hamon, Geffroy placed the bomb on the monument, which portrayed the duchess Anne of Brittany kneeling before King Charles VIII of France.[3]

Two people were crossing the Town Hall Square at the time but they subsequently refrained from saying what they had seen, despite the offer of a reward. The explosion tore the mass of bronze from its niche and smashed it on the ground. All the windows within a hundred metres were shattered. Parts of the sculpture have been preserved.

In 1936 Lainé created the Kadervenn (Combat tool), a paramilitary unit based on the IRA model, comprising a dozen members engaged in military manoeuvres. This organisation instructed new recruits and in 1938 participated in exercises in the Landes de Lanvaux, a belt of heath and woodland north of Vannes. The following year he spent a period in Germany where he organized the delivery of a batch of arms, which was shipped on board the ship Gwalarn. However, the ship beached at Locquirec in the night of the 8th and 9 August 1939. The arms were recovered and stored in the abbey at Boquen.

Collaboration

Before and during the Second World War, Lainé sided with the Germans. He favoured aggressive tactics and sought to establish a distinct Breton army to work with the Nazis against the French state. ("We will continue the tradition of those who, throughout the centuries, have struggled, arms in hand, to affirm our national rights.") With Yann Goulet he participated in the creation of the Bagadou Stourm (Stormtroopers).[4] He also set up a unit of volunteers that he controlled personally, called the Service Spécial (or Lu Brezhon in Breton). This paramilitary unit was in charge of the maintenance of order within the Breton National Party.

In 1941, Lainé helped to oust Olier Mordrel from the leadership of the Breton National Party when it became evident that the Germans objected to his strident anti-Vichy position. There followed a split between the Bagadou Stourm and the Service Spécial, as Lainé became increasingly close to the Nazis. On the 11 September 1943, at Rennes, he and Colonel Hartmut Pulmer (chief of the Sicherheitsdienst at Rennes) signed the foundation convention of a new unit to be called Bezen Kadoudal, named after the Breton rebel Georges Cadoudal. In 1944 it took the new name Bezen Perrot (Perrot Militia), the name referring to Abbé Perrot, a parish priest and ardent defender of the Breton language who had recently been assassinated by the French Resistance. His group brought together around a hundred people; his deputy was Alan Heusaff. In 1943, the organisation functioned as an auxiliary police force for the Nazis fighting against the Resistance. The soldiers of Bezen Perrot enrolled in the Waffen-SS, wearing SS field-uniforms. In May 1944, he symbolically founded a new Breton national party on extreme nationalist lines. At the Liberation of France, these collaborationist activities brought opprobrium on the whole of the Breton movement.

Exile

Hunted out of Brittany after the defeat of the Nazis, the last fighters of this unit found themselves at Tübingen, from which many stayed in Germany under false identities, assisted by Leo Weisgerber. Sentenced to death in absentia, Lainé fled to Ireland, where he lived in various locations, including in County Dublin and at Oranmore in County Galway, until his death in 1983.[5]

Olier Mordrel, co-founder of the Breton independence party,[which?] wrote that Lainé "was a strange man. He had become the prophet of a Celtic religion made for himself, where Nordic racism was married to the Nietzschian will to power, and not without flirting with an air of romantic druidism".

Notes

  1. ^ "Daniel Leach, Bezen Perrot: The Breton nationalist unit of the SS, 1943-5, pp.4-5". Archived from the original on 2010-12-11. Retrieved 2009-12-03.
  2. ^ See the external link, Gwen ha Du. davantage en français.
  3. ^ L'Union de la Bretagne à La France
  4. ^ Bagadou means 'troops': stourm means 'combat' or 'struggle': a name clearly based on that of the German Sturmtruppen, developed during the First World War to pass through enemy lines in small numbers and to harass the enemy's immediate rear while other troops followed up with a frontal attack.
  5. ^ "Liberators and victims: Ireland and the Holocaust". independent.ie. 20 January 2020.

References

Read other articles:

غودنسبرغ    شعار   الإحداثيات 51°10′34″N 9°21′27″E / 51.1762°N 9.3575°E / 51.1762; 9.3575  [1] تقسيم إداري  البلد ألمانيا[2][3]  خصائص جغرافية  المساحة 46.49 كيلومتر مربع (31 ديسمبر 2017)[4]  ارتفاع 228 متر  عدد السكان  عدد السكان 9983 (31 ديسمبر 2022)[5] …

Kleine Polder kan verwijzen naar: Kleine Polder (Delfzijl), Groningen Kleine Polder (Termunterzijl), Groningen de oorspronkelijke vaan van de Fockenspolder, Groningen Kleine polder (Groede), Zeeland De Kleine Polder, een particuliere polder in Friesland Zie ook Kleinpolder Bekijk alle artikelen waarvan de titel begint met Kleine Polder of met Kleine Polder in de titel. Dit is een doorverwijspagina, bedoeld om de verschillen in betekenis of gebruik van Kleine Polder inzic…

Historic carousel in Portland, Oregon, U.S. United States historic placeWilliam F. Mangels Four-Row CarouselU.S. National Register of Historic Places The Mangels Carousel in Washington Park in 1987.Location4033 SW Canyon RoadPortland, OregonCoordinates45°30′38″N 122°43′05″W / 45.510439°N 122.718173°W / 45.510439; -122.718173Arealess than one acreBuilt1914ArchitectW. F. Mangels Co. Carousel Works, Marcus Charles IllionsMPSOregon Historic Wooden Carousels TRNRHP…

село Новоямська Слобода рос. Новоямская Слободаерз. Новоямская Слобода Країна  Росія Суб'єкт Російської Федерації Мордовія Муніципальний район Єльниківський район Поселення Новоямське Код ЗКАТУ: 89218875001 Код ЗКТМО: 89618475101 Основні дані Населення 280 осіб (2010[1]) Поштови

Airport in West Palm Beach, Florida, US Palm Beach Airport redirects here. For other uses, see Palm Beach Airport (disambiguation). Palm Beach International AirportIATA: PBIICAO: KPBIFAA LID: PBIWMO: 72203SummaryAirport typePublicOwner/OperatorPalm Beach County Department of AirportsServesMiami metropolitan areaLocationUnincorporated Palm Beach County, adjacent to West Palm BeachOpened1936Elevation AMSL19 ft / 6 mCoordinates26°40′59″N 80°05′44″W / 26.6830…

State park in Burlington County, New Jersey Rancocas State ParkRancocas State Park in September 2010Rancocas State ParkLocation in New JerseyShow map of New JerseyRancocas State ParkLocation in United StatesShow map of the United StatesLocationHainesport and Westampton, New JerseyCoordinates40°0′27.13″N 74°49′59.59″W / 40.0075361°N 74.8332194°W / 40.0075361; -74.8332194[1]Area1,252 acres (5.07 km2)Opened1965Operated byNew Jersey Division of P…

Xfresh FM merupakan stasiun radio di Malaysia yang terkenal hanya karena memutarkan lagu-lagu Malaysia. Stasiun ini menargetkan pendengar dari kalangan remaja. Xfresh FM diresmikanpada Oktober 2004 setelah lama mengudara di Astro Radio dan DVRPlayer dengan nama Varia. Xfresh FM merupakan salah satu komponen portal web remaja Xfresh di bawah naungan AMP Radio Networks. Lihat pula Daftar stasiun radio Malaysia Artikel bertopik Malaysia ini adalah sebuah rintisan. Anda dapat membantu Wikipedia deng…

Frontispiz des Prodromus Monumentorum Guelficorum mit einem Porträt des Abtes Dominikus Schnitzer und zwei Ansichten des Klosters Weingarten, 1781 Gerhard Hess, auch latinisiert Gerardus Hess (* 11. Oktober 1731 in Oberstetten bei Ochsenhausen; † 4. Dezember 1802 in Thüringen) war ein deutscher Benediktinermönch und Historiker. Hess studierte in Innsbruck Philosophie und trat 1750 in das Kloster Weingarten ein. 1752 legte er die Profess ab, 1755 wurde er zum Priester geweiht. Hess lehrte in…

Questa voce sull'argomento partiti politici europei è solo un abbozzo. Contribuisci a migliorarla secondo le convenzioni di Wikipedia. Gruppo del Partito del Socialismo Europeo Stato Unione europea Fondazione21 aprile 1993 Dissoluzione23 giugno 2009 Confluito inAlleanza Progressista dei Socialisti e dei Democratici PartitoPartito del Socialismo Europeo IdeologiaSocialdemocrazia CollocazioneCentro-sinistra / Sinistra Modifica dati su Wikidata · Manuale Il Gruppo del Part…

Place in Lower Carniola, SloveniaZgornja DragaZgornja DragaLocation in SloveniaCoordinates: 45°56′26.42″N 14°46′45.11″E / 45.9406722°N 14.7791972°E / 45.9406722; 14.7791972Country SloveniaTraditional regionLower CarniolaStatistical regionCentral SloveniaMunicipalityIvančna GoricaArea • Total2.34 km2 (0.90 sq mi)Elevation334.6 m (1,097.8 ft)Population (2002) • Total131[1] Zgornja Draga (pronounced &…

American television soap opera All My ChildrenAlso known asAMCGenreSoap operaCreated byAgnes NixonWritten bySee belowStarringSeries castCountry of originUnited StatesOriginal languageEnglishNo. of episodesABC: 10,712 (television)TOLN: 43 (internet and television)Total: 10,755ProductionExecutive producersAgnes Nixon (1970–1982)Bud Kloss (1970–1978)Jorn Winther (1978–1982)Jacqueline Babbin (1982–1986)Jorn Winther (1986–1987)Stephen Schenkel (1987–1989)Felicia Minei Behr (1989–1996)Fr…

  لمعانٍ أخرى، طالع تعزيز (توضيح). هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (ديسمبر 2016) التعزيز هو نوع من التحسين يتم من خلاله تقليل حساسية النظام لتأثيرات التغيرات العشوائية أو الضجيج الموجود في متغيرات إد…

Le cancer des fileurs de coton ou cancer de la mule-jenny était une forme de cancer, un épithélioma du scrotum. Il a été signalé pour la première fois en 1887 dans une filature de coton utilisant la mule-jenny[1]. En 1926, un comité du gouvernement britannique a approuvé l'idée que cette forme de cancer était provoquée par l'action prolongée des huiles minérales sur la peau du scrotum, et parmi ces huiles, l'huile de schiste a été estimée la plus cancérogène. De 1911 à 1938, …

Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of the C…

Charity in United States This article contains content that is written like an advertisement. Please help improve it by removing promotional content and inappropriate external links, and by adding encyclopedic content written from a neutral point of view. (May 2014) (Learn how and when to remove this template message) Fisher House FoundationFounded1990FounderZachary and Elizabeth FisherTypeNon-Profit OrganizationFocusService members, veterans and their familiesLocationRockville, Maryland, U.S.Me…

Three-mirror telescope design Simple Nasmyth telescope 56cm Nasmyth-Cassegrain Telescope at the Walter-Hohmann-Observatory in Essen, Germany The Nasmyth telescope, also called Nasmyth–Cassegrain or Cassegrain–Nasmyth, is a reflecting telescope developed by the Scottish inventor James Nasmyth. It is a modified form of a Cassegrain telescope, with light reflected sideways to an eyepiece. Scheme As in the Cassegrain telescope, the light falls on a concave primary mirror, then is reflected towar…

American athletic equipment company This article is about the company. For other uses, see Nike (disambiguation). Nike, Inc.Headquarters near Beaverton, Oregon, U.S.FormerlyBlue Ribbon Sports, Inc. (1964–1971)TypePublicTraded asNYSE: NKE (Class B)DJIA componentS&P 100 componentS&P 500 componentISINUS6541061031IndustryApparelAccessoriesSports equipmentFoundedJanuary 25, 1964; 59 years ago (1964-01-25)FoundersBill BowermanPhil KnightHeadquartersNike World Headquart…

Chilean biochemist and biophysicist In this Spanish name, the first or paternal surname is Allende and the second or maternal family name is Rivera. Jorge E. AllendeJorge E. Allende in Barcelona, 2017Born (1934-11-11) 11 November 1934 (age 89)Cartago, Costa RicaNationalityChileanAlma materLouisiana State University Yale University Rockefeller UniversityKnown forProtein biosynthesis, Institute of Biomedical Sciences (ICBM) at Universidad de ChileSpouseCatherine ConnellyChil…

A constituent college of University of Delhi Maitreyi CollegeTypeGovernmentEstablishedJuly 1967PrincipalDr. Haritma Chopra[1]AddressBapudham Complex, Chanakyapuri[2], New Delhi, Delhi, IndiaCampusUrbanAffiliationsUniversity of DelhiWebsitemaitreyi.ac.in Maitreyi College is a women's college in the South Campus of the University of Delhi, located in Bapu Dham, Chanakyapuri, New Delhi-110021, India. It was established in July 1967 and named after the Vedic sage Maitreyi.[3]…

For the parent multisport club, see SD Vojvodina. Vojvodina NS Seme Novi SadFull nameOdbojkaški klub VojvodinaShort nameOK VojvodinaNicknameVošaFounded1946GroundSPENS, Novi Sad(Capacity: 6,987–Main Hall, 1,030–Small Hall)ManagerSlobodan BoškanLeagueWiener Städtische LeagueWebsiteClub home pageUniforms Home Away Active sport clubs of SD Vojvodina Football(Men's)Basketball(Men's)VolleyballWater PoloBasketball (Women's)HandballAthleticsTennisWrestlingJudoIce HockeySwimmingRugbyKarateCanoe O…

Kembali kehalaman sebelumnya

Lokasi Pengunjung: 3.145.33.252