ENKD1

ENKD1
Identifikatori
AliasiENKD1
Vanjski ID-jeviMGI: 2142593 HomoloGene: 12957 GeneCards: ENKD1
Lokacija gena (čovjek)
Hromosom 16 (čovjek)
Hrom.Hromosom 16 (čovjek)[1]
Hromosom 16 (čovjek)
Genomska lokacija za ENKD1
Genomska lokacija za ENKD1
Bend16q22.1Početak67,662,945 bp[1]
Kraj67,667,265 bp[1]
Lokacija gena (miš)
Hromosom 8 (miš)
Hrom.Hromosom 8 (miš)[2]
Hromosom 8 (miš)
Genomska lokacija za ENKD1
Genomska lokacija za ENKD1
Bend8|8 D3Početak106,430,283 bp[2]
Kraj106,434,842 bp[2]
Ortolozi
VrsteČovjekMiš
Entrez

84080

102124

Ensembl

ENSG00000124074

ENSMUSG00000013155

UniProt

Q9H0I2

Q7TSV9

RefSeq (mRNK)

NM_032140

NM_198299

RefSeq (bjelančevina)

NP_115516

NP_938041

Lokacija (UCSC)Chr 16: 67.66 – 67.67 MbChr 8: 106.43 – 106.43 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Protein 1 sa enkurinskim domenom je protein koji je kod ljudi kodiran genom ENKD1.[5][6]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 346 aminokiselina, a molekulska težina 38.759 Da.[7]

Simboli

C: Cistein
D: Asparaginska kiselina
E: Glutaminska kiselina
F: Fenilalanin
G: Glicin
H: Histidin
I: Izoleucin
K: Lizin
L: Leucin
M: Metionin
N: Asparagin
P: Prolin

Q: Glutamin
R: Arginin
S: Serin
T: Treonin
V: Valin
W: Triptofan
Y: Tirozin

1020304050
MCEGPSRISGPIPPDPTLCPDNYRRPTSAQGRLEGNALKLDLLTSDRALD
TTAPRGPCIGPGAGEILERGQRGVGDVLLQLEGISLGPGASLKRKDPKDH
EKENLRRIREIQKRFREQERSREQGQPRPLKALWRSPKYDKVESRVKAQL
QEPGPASGTESAHFLRAHSRCGPGLPPPHVSSPQPTPPGPEAKEPGLGVD
FIRHNARAAKRAPRRHSCSLQVLAQVLEQQRQAQEHYNATQKGHVPHYLL
ERRDLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKLLQSQSQLLR
ELVLLPAGADSLRAQSHRAELDRKLVQVEEAIKIFSRPKVFVKMDD

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000124074 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000013155 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A (Mar 2001). "Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs". Genome Res. 11 (3): 422–35. doi:10.1101/gr.GR1547R. PMC 311072. PMID 11230166.
  6. ^ "Entrez Gene: C16orf48 chromosome 16 open reading frame 48".
  7. ^ "UniProt, Q9H0I2". Pristupljeno 5. 7. 2021.

Dopunska literatura

Read other articles:

The Block (Sydney)

Social housing in Redfern, Sydney The Block at Eveleigh Street with Aboriginal flag mural, vacant lots and deteriorated terraces c. 2003. The Block is a colloquial but universally applied name given to a residential block of social housing in the suburb of Redfern, Sydney, bound by Eveleigh, Caroline, Louis and Vine Streets. Beginning in 1973, houses on this block were purchased over a period of 30 years by the Aboriginal Housing Company (AHC) for use as a project in Aboriginal-managed housin...

 

Allan Simonsen (pembalap)

Allan SimonsenSimonsen pada tahun 2011Kebangsaan DenmarkLahir(1978-07-05)5 Juli 1978Odense, DenmarkMeninggal22 Juni 2013(2013-06-22) (umur 34)Le Mans, PrancisAjang sebelumnya1999199920002001200120022003–20042003–200720052005–201220062006, 20082006–20092007–2013200820092009, 20122009–20122010, 20122010, 20122010–20122011–20132012–20132013Formula Ford 1800 NetherlandsDanish Formula Ford ChampionshipFormula Palmer AudiGerman Formula Three ChampionshipBritish Formula Renaul...

 

Asian Food Network

Asian Food NetworkDiluncurkan12 Agustus 2005PemilikWarner Bros. Discovery International(Warner Bros. Discovery)Negara SingapuraKantor pusatFusionopolis, One-North Business Park, SingapuraSitus webwww.asianfoodnetwork.com Asian Food Network (AFN), sebelumnya bernama Asian Food Channel (AFC), adalah saluran televisi makanan dan gaya hidup yang berbasis di Singapura. Sebagai saluran televisi makanan pertama yang disiarkan secara regional di Asia, AFN menyediakan perpaduan antara konten Timu...

The Zookeeper's Wife (film)

The Zookeeper's WifePoster film The Zookeeper's WifeSutradaraNiki CaroProduserJeff AbberleyJamie PatricofDiane Miller LevinKim ZubickRobbie TollinDitulis olehAngela WorkmanBerdasarkanThe Zookeeper's Wifeoleh Diane AckermanPemeranJessica ChastainJohan HeldenberghMichael McElhattonDaniel BrühlPenata musikHarry Gregson-WilliamsSinematograferAndrij ParekhPenyuntingDavid CoulsonPerusahaanproduksiScion FilmsElectric City EntertainmentTollin ProductionsRowe/Miller ProductionsDistributorFocus ...

 

Havraníky

Cet article est une ébauche concernant une localité tchèque. Vous pouvez partager vos connaissances en l’améliorant (comment ?) selon les recommandations des projets correspondants. Havraníky   Administration Pays Tchéquie Région Moravie-du-Sud District Znojmo Région historique Moravie Maire Aleš Kňazovčík Code postal 669 02 Démographie Population 324 hab. (2020) Densité 35 hab./km2 Géographie Coordonnées 48° 48′ 52″ nord, 16° 0...

 

Rayon lumineux

Lasers visibles Lasers rouges : 635 nm, 660 nm Lasers verts : 520 nm, 532 nm Lasers bleus : 405 nm, 445 nm Le rayon lumineux est une notion d'optique et un outil mathématique, utilisé principalement en optique géométrique, décrivant le trajet de la lumière de manière simplificatrice, valable uniquement lorsque le rayon lumineux se propage dans des milieux où les obstacles et composants optiques ont des dimensions très supérieures à la longueur d'onde. Un rayon lumine...

Tusuk ranting

Gambar sulaman Kreta dengan jahitan Kreta tertutup dari Tenun Sulaman dan Permadani, 1912 Tusuk ranting adalah teknik menyulam yang terbuat dari tusuk jahit terbuka dan melingkar yang dikerjakan secara bergantian di kanan dan kiri tulangan tengah. [1] Aplikasi Tusuk ranting merupakan jahitan dekoratif yang biasanya disertai dengan hiasan. Catatan ^ Reader's Digest Complete Guide to Needlework. The Reader's Digest Association, Inc. (March 1992). ISBN 0-89577-059-8, p. 39-41

 

Gex (series)

Platform video game series Video game seriesGexLogotype from the first gameGenre(s)PlatformDeveloper(s) Crystal Dynamics Publisher(s) Crave Entertainment Eidos Interactive Midway Games Sony Interactive Entertainment Square Enix Platform(s) 3DO Game Boy Color Microsoft Windows Nintendo 64 PlayStation Sega Saturn First releaseGexApril 1995Latest releaseGex 3: Deep Cover GeckoMarch 23, 1999 Gex is a platformer video game series, developed by Crystal Dynamics, that details the adventures of an an...

 

Antimigraine drug

Medication intended to reduce the effects or intensity of migraine headache Antimigraine drugDrug classZolmitriptan, a common antimigraine medicationClass identifiersUseMigraine therapy and preventionATC codeN02CClinical dataDrugs.comDrug ClassesLegal statusIn Wikidata Antimigraine drugs are medications intended to reduce the effects or intensity of migraine headache. They include drugs for the treatment of acute migraine symptoms as well as drugs for the prevention of migraine attacks.[1...

Chypre au Concours Eurovision de la chanson 2020

Chypreau Concours Eurovision 2020 Données clés Pays  Chypre Chanson Running Interprète Sandro Sélection nationale Radiodiffuseur RIK Type de sélection Sélection interne Date 29 novembre 2019 (artiste) 6 mars 2020 (chanson) Concours Eurovision de la chanson 2020 2019 2021 modifier Chypre était l'un des quarante et un pays participants prévus du Concours Eurovision de la chanson 2020, qui aurait dû se dérouler à Rotterdam aux Pays-Bas. Le pays aurait été représenté par le c...

 

Yiğitcan Saybir

Questa voce sull'argomento cestisti turchi è solo un abbozzo. Contribuisci a migliorarla secondo le convenzioni di Wikipedia. Segui i suggerimenti del progetto di riferimento. Yiğitcan Saybir Nazionalità  Turchia Altezza 201 cm Peso 87 kg Pallacanestro Ruolo Ala grande Squadra  Bursaspor CarrieraGiovanili  Anadolu EfesSquadre di club 2017-2022 Anadolu Efes61 (299)2022- BursasporNazionale 2016 Turchia U-172016-2017 Turchia U-182022- TurchiaPalmarès  Mond...

 

Graignes-Mesnil-Angot

Pour les articles homonymes, voir Angot. Graignes-Mesnil-Angot L'église Saint-Michel et la mairie. Administration Pays France Région Normandie Département Manche Arrondissement Saint-Lô Intercommunalité Saint-Lô Agglo Maire Mandat Jean-Pierre Guégan 2020-2026 Code postal 50620 Code commune 50216 Démographie Gentilé Graignais et Mesnil-Angotais Populationmunicipale 798 hab. (2021 ) Densité 43 hab./km2 Géographie Coordonnées 49° 14′ 17″ nord, 1° ...

حفل توزيع جوائز الأوسكار الرابع

حفل توزيع جوائز الأوسكار الرابع   الجائزة Academy Awards التاريخ 10 نوفمبر 1931 (10 نوفمبر 1931) المكان فندق بيلتمور البلد الولايات المتحدة  المضيف لورانس غرانت الجوائز أفضل فيلم سيمارون الأكثر فوزا سيمارون أكثر ترشيح سيمارون الموقع الرسمي الموقع الرسمي  حفل توزيع جوائز الأ...

 

مورغان هيل

مورغان هيل    علم   الإحداثيات 37°07′50″N 121°39′16″W / 37.130555555556°N 121.65444444444°W / 37.130555555556; -121.65444444444   [1] تاريخ التأسيس 10 نوفمبر 1906  تقسيم إداري  البلد الولايات المتحدة[2][3]  التقسيم الأعلى مقاطعة سانتا كلارا  خصائص جغرافية  المساحة 33.05490...

 

Giorgio de Chirico

Giorgio de ChiricoLahirGiorgio de Chirico10 Juli 1888Volos, YunaniMeninggal20 November 1978Roma, ItaliaKebangsaanItaliPendidikanAcademy of Fine Arts, MunichDikenal ataslukisan, seni pahat, Giorgio de Chirico adalah seorang pelukis asal Italia yang lahir pada tanggal 10 Juli 1888 di Volos, Yunani dan meninggal pada tanggal 19 November 1978 di Roma, Italia.[1] Bersama dengan Carlo Carrà dan Giorgio Morandi, dia telah menemukan gaya penglusikan metafisika (Metaphysical painting).[1...

The Lion's Den (film 1919)

The Lion's DenSutradaraGeorge D. BakerProduserMetro PicturesDitulis olehGeorge D. BakerPemeranBert LytellSinematograferRobert KurrleDistributorMetro PicturesTanggal rilis19 Mei 1919NegaraAmerika SerikatBahasaBisu (intertitel Inggris) The Lion's Den adalah sebuah film drama bisu Amerika Serikat tahun 1919 garapan George D. Baker dan menampilkan Bert Lytell, Alice Lake dan Edward Connelly. Film tersebut didistribusikan oleh Metro Pictures.[1] Pemeran Bert Lytell Alice Lake Joseph Kilgou...

 

الانتخابات الفيدرالية الألمانية الغربية 1953

1953 West German federal election ألمانيا   → 1949 West German federal election عدد الناخبين 33120940   إجمالي الأصوات 28479550   عدد الأصوات المقبولة 27551272     الحزب FDP   الحزب CDU/CSU الوسط أجريت الانتخابات الفيدرالية في ألمانيا الغربية في 6 سبتمبر 1953 لانتخاب البوندستاغ الثاني. برز الاتحاد المسيحي...

 

Annesley

For other uses, see Annesley (disambiguation).Village and civil parish in Nottinghamshire, England Village and civil parish in EnglandAnnesleyVillage and civil parishRobin Hood HillsParish mapAnnesleyLocation within NottinghamshireArea4.85 sq mi (12.6 km2)Population1,814 (2021)• Density374/sq mi (144/km2)OS grid referenceSK 508534• London115 mi (185 km) SSEDistrictAshfieldShire countyNottinghamshireRegionEast MidlandsCountry...

Nord Pool

This article is about the present-day power exchange that was spun off from Nord Pool ASA in 2001 and acquired by Euronext in 2019. For the energy market derivatives exchange that resulted from Nasdaq OMX's acquisition of Nord Pool ASA's remaining parts between 2007 and 2010, see NASDAQ OMX Commodities Europe. Pan-European electric power exchange 59°54′55″N 10°38′18″E / 59.91528°N 10.63833°E / 59.91528; 10.63833 Nord Pool ASLogotype since 2016Current market...

 

FIS Nordic World Ski Championships 2015 – Men's team sprint

Men's team sprint at the FIS Nordic World Ski Championships 2015Date22 February 2015Competitors56 from 28 nationsWinning time15:32.89Medalists  Finn Hågen KroghPetter Northug   Norway Alexey PetukhovNikita Kryukov   Russia Dietmar NöcklerFederico Pellegrino   Italy← 20132017 → FIS Nordic WorldSki Championships 2015Cross-country skiingSprintmenwomenInterval start15 km men10 km womenPursuit30 km men15...