Read other articles:
Boikot, Divestasi, dan SanksiBoycott, Divestment and Sanctions Unjuk rasa BDS di Melbourne, Australia, menolak blokade Gaza oleh Israel dan serangan terhadap armada kapal kemanusiaan tahun 2010. Yahudi Haredi di Yerusalem memegang bendera Palestina disertai teks Boycott Israel.SingkatanBDSTanggal pendirian9 Juli 2005PendiriOmar Barghouti, Ramy ShaatTipeOrganisasi nirlabaTujuanBoikotBadan utamaKomite Nasional BDS PalestinaSitus webbdsmovement.net Boikot, Divestasi, dan Sanksi (Inggris: Boycott...
Dataran Donau di Bulgaria. Dataran Donau di Bulgaria terletak di bagian utara negara ini.[1] Referensi ^ Eni, S. P., dan Tsabit, A. H. (2014). Arsitektur Kuno Bulgaria di Eropa Timur: Sejarah, Kebudayaan, Arkeologi (PDF). Jakarta: Rajawali Press. hlm. 6. ISBN 978-979-769-809-6. Parameter |url-status= yang tidak diketahui akan diabaikan (bantuan)Pemeliharaan CS1: Banyak nama: authors list (link)
Bakungan Klasifikasi ilmiah Domain: Eukaryota Kerajaan: Plantae Divisi: Magnoliophyta Kelas: Liliopsida Subkelas: Liliidae Ordo: Asparagales Famili: Amaryllidaceae Subfamili: Amaryllidoideae Genus: Hymenocallis Spesies: Hymenocallis littoralis(Jacq.) Salisb. Sinonim[1] Pancratium littoraleJacq. Troxistemon littorale (Jacq.) Raf. Hymenocallis adnata var. dryandri (Ker Gawl.) Kunth Hymenocallis adnata var. staplesiana Herb. Hymenocallis americana fo. staplesiana (Herb.) Voss Hymenocall...
Kabupaten BeluKabupatenTari Likurai LambangMotto: Husar Binan Rai Belu Tetuk No Nesan Diak No KmanekDengan semangat persaudaraan kita membangun masyarakat Belu menuju tercapainya kesejahteraan lahir batin yang serasi dan seimbang[1][2]PetaKabupaten BeluPetaTampilkan peta Kepulauan Sunda KecilKabupaten BeluKabupaten Belu (Indonesia)Tampilkan peta IndonesiaKoordinat: 9°06′S 124°54′E / 9.1°S 124.9°E / -9.1; 124.9Negara IndonesiaProvinsiNu...
Artikel ini perlu dikembangkan agar dapat memenuhi kriteria sebagai entri Wikipedia.Bantulah untuk mengembangkan artikel ini. Jika tidak dikembangkan, artikel ini akan dihapus. Tom McGrathMcGrath di San Diego Comic-Con International 2016 dengan mempromosikan The Boss BabyLahirThomas McGrath07 Agustus 1964 (umur 59)Lynnwood, Washington, ASPekerjaanPengisi suara, animator, sutradara film, penulis naskahTahun aktif1988–sekarangTempat kerjaDreamWorks AnimationKarya terkenalMadagascar ...
2016 multiplayer first-person shooter video game 2016 video gameBattlebornDeveloper(s)Gearbox SoftwarePublisher(s)2KDirector(s)Randy VarnellProducer(s)Chris BrockDesigner(s)John MulkeyProgrammer(s)Neil Johnson / Scott Velasquez / Chase SenskyArtist(s)Scott KesterWriter(s)Aaron LindeComposer(s)Cris VelascoKevin RieplMike RubinoEngineUnreal Engine 3[1]Platform(s)PlayStation 4WindowsXbox OneReleaseMay 3, 2016Genre(s)First-person shooterMode(s)Single-player, multiplayer Battleborn was a f...
PaléoichnologieLe Ciampate del Diavolo (en) (littéralement le « sentier du Diable ») sur les pentes du volcan Roccamonfina (en). Considérées par le folklore local comme les traces de pas du Diable, seule créature capable de marcher dans la lave, ce sont en réalité des empreintes fossiles humaines.Partie de Ichnologie (en), paléontologiemodifier - modifier le code - modifier Wikidata La paléoichnologie (du grec : palaios, ancien ; ιχνος, ikhnos, em...
Рой частиц, ищущий глобальный минимум функции Метод роя частиц (МРЧ) — метод численной оптимизации, для использования которого не требуется знать точного градиента оптимизируемой функции. МРЧ был доказан Кеннеди, Эберхартом и Ши[1][2] и изначально предназначал...
Defunct American manufacturing conglomerate Rockwell InternationalRockwell Manufacturing CompanyCompany typeConglomerateFounded1919; 105 years ago (1919) by creation of automotive component company and organic growth, later acquisitions and then ultimate 1973 mergerDefunct2001; 23 years ago (2001)Fate Division sold Split to several companies Successor Boeing Integrated Defense Systems BTR plc Conexant Technologies Meritor Rockwell Automation Rockwell Collin...
Questa voce sull'argomento cestisti cileni è solo un abbozzo. Contribuisci a migliorarla secondo le convenzioni di Wikipedia. Segui i suggerimenti del progetto di riferimento. Orlando Silva Nazionalità Cile Pallacanestro CarrieraNazionale 1951-1959 CilePalmarès Mondiali Bronzo Cile 1959 Campionati sudamericani Bronzo Uruguay 1953 Il simbolo → indica un trasferimento in prestito. Modifica dati su Wikidata · Manuale Orlando Silva Infante (Santiago del C...
Regional anthem of Wallonia, BelgiumLe Chant des WallonsEnglish: The Song of the WalloonsRegional anthem of WalloniaLyricsThéophile Bovy, 1900MusicLouis Hillier, 1901Adopted1998Audio sampleInstrumental rendition in B-flat major.filehelp The Song of the Walloons (Walloon: Li tchant des Walons; French: Le Chant des Wallons) is the regional anthem of Wallonia in Belgium. The original lyrics were written by Théophile Bovy in 1900 in the Walloon language. A year later, it was set to music c...
American screenwriter, film director, actress, and comedian (born 1932) Elaine MayMay performing in 1959BornElaine Iva Berlin (1932-04-21) April 21, 1932 (age 92)Philadelphia, Pennsylvania, U.S.Other namesEsther Dale, Elly MayOccupationsActresscomedianplaywrightscreenwriterfilm directorYears active1955–presentKnown for A New Leaf (1971) The Heartbreak Kid (1972) Mikey and Nicky (1976) Ishtar (1987) Spouses Marvin Irving May (m. 1948; d...
هذه المقالة عن النصوص والكتب المقدسة للأديان بشكل عام. لالكتاب المقدس اليهودي-المسيحي، طالع الكتاب المقدس. آيات الإسلام المقدسة، القرآن الكريم – المتحف الوطني، نيودلهي، الهند مخطوطة ريگفدا من القرن ال19، وريگفدا هي أحد أربعة نصوص مقدسة قانونية في الهندوسية وإحدى أ�...
British Labour Party politician, activist, humanitarian and educationist Mabel TylecoteDame Mabel Tylecote in 1966Born4 February 1896 Crumpsall Died31 January 1987 (aged 90)Whalley Range Alma materVictoria University of Manchester EmployerVictoria University of Manchester (1926–1930) Political partyLabour Party Spouse(s)Frank Edward Tylecote AwardsDame Commander of the Order of the British Empire (1966)honorary doctor of the University of Ma...
Polish fencer (born 1942) Michał ButkiewiczPersonal informationBorn (1942-08-18) 18 August 1942 (age 81)Warsaw, PolandSportSportFencing Medal record Men's fencing Representing Poland Olympic Games 1968 Mexico City Épée, team Michał Butkiewicz (born 18 August 1942) is a Polish fencer. He won a bronze medal in the team épée event at the 1968 Summer Olympics.[1][2] References ^ Olympics Statistics: Michał Butkiewicz. databaseolympics.com. Archived from the origi...
Theo CrokerInformasi latar belakangNama lahirTheodore Lee CrokerLahirLeesburg, FloridaGenreJazzpopexperimentalhip hopfunksoulR&BPekerjaan Trumpeter komposer pemimpin band produser Instrumen Trumpet vocal piano drum flugel horn keyboard Tahun aktif2000–sekarangLabelDDB RecordsSony MasterworksOkeh RecordsArtis terkaitDee Dee BridgewaterGary BartzBenny GolsonCommonAri LennoxJ.coleKarriem RigginsRoy HargroveChronixxChina MosesLeon WareSitus webhttp://www.theocroker.com Theodore Lee Croker (...
Come leggere il tassoboxMalaxidinaeLiparis nutansClassificazione APG IVDominioEukaryota RegnoPlantae (clade)Angiosperme (clade)Mesangiosperme (clade)Monocotiledoni OrdineAsparagales FamigliaOrchidaceae SottofamigliaEpidendroideae Classificazione CronquistDominioEukaryota RegnoPlantae SuperdivisioneSpermatophyta DivisioneMagnoliophyta ClasseLiliopsida SottoclasseLiliidae OrdineOrchidales FamigliaOrchidaceae SottofamigliaEpidendroideae TribùMalaxideae SottotribùMalaxidinae Generi Alatiliparis...
City in Minnesota, United States St. Augusta redirects here. For the saint, see Augusta of Treviso. City in Minnesota, United StatesSt. AugustaCityMotto: Where Country Meets CommunitySt. AugustaLocation of Saint Augustawithin Stearns County and state of MinnesotaCoordinates: 45°26′59″N 94°11′58″W / 45.44972°N 94.19944°W / 45.44972; -94.19944CountryUnited StatesStateMinnesotaCountyStearnsSettled1854Organized1859IncorporatedMay 2, 2000Government •...
Bilateral relationsNorway-Sweden relations Norway Sweden Diplomatic missionEmbassy of Norway in StockholmEmbassy of Sweden in OsloEnvoyAmbassador Anne K. LundAmbassador Axel Wernhof Norway and Sweden have a very long history together. They were both part of the Kalmar Union between 1397 and 1523, and a personal union between 1814 and 1905. The countries established diplomatic relations in 1905, after the dissolution of the union. Sweden has an embassy in Oslo and 14 consulates, in Ålesund, A...
Northern Hemispheric cooling period The Late Antique Little Ice Age is seen between the middle of the 6th century and the start of the 7th century, and preceded by the Roman Warm Period.[1] The Late Antique Little Ice Age (LALIA) was a long-lasting Northern Hemispheric cooling period in the 6th and 7th centuries AD, during the period known as Late Antiquity. The period coincides with three large volcanic eruptions in 535/536, 539/540 and 547. The volcanic winter of 536 was the early p...